Tap / click on image to see more RealViewsTM
$241.85
per window cling
 

Generic Customise Fried Crispy Chicken 2 Front

Qty:
Personalise this template
[40.0000,52.0000]
Automatic Opaque Design: White Underbase
Custom Cut

Other designs from this category

About Window Clings

Sold by

Shape: Custom Cut

Turn your glass surfaces into decorations, promotions, signage and more with custom window clings. These versatile and reusable vinyl clings stick to glass surfaces through static electricity so leave no sticky residue behind. From displaying new promotions on your business’s window and using that empty window space to boost your brand, to decorating a window in your home, you’ll find so many great uses for these clings.

  • Dynamically Sized - ranging from 10cm x 10cm to a max of 132cm x 183cm (or max 183cm x 132cm if horizontal/landscape is selected)
  • Material - 7.5 mil static cling vinyl
  • Non Adhesive: Sticks to glass surfaces electro-statically
  • Choose from rectangle or custom cut shapes

Application Instructions:

  • Clean the surface you wish to apply the window cling to with hot water and dishwasher soap and wait until dry
  • Next, apply a light mist of water to your surface. Peel the decal from backing paper and place it on your surface, slide it around until you’re happy with its placement
  • Once it’s positioned perfectly, use a squeegee or flat plastic card to remove any air bubbles and wipe your window dry
  • To reposition or remove, simply peel away. It’s non-adhesive so there’ll be no residue left on the surface

Print Process: Automatic Opaque Design: White Underbase

Art is printed on a transparent sheet of plastic, but white ink is printed beneath all art, making those areas opaque while also making colours vivid

Adhesive: Cling art faces outwards

Adhesive side is on the front of the window cling. All text and art is printed on the front of the window cling and faces away from the person applying it to the window. The art and text printed on the window cling will appear correctly when viewed from the opposite side of the window that it has been applied to.

About This Design

Generic Customise Fried Crispy Chicken 2 Front

Generic Customise Fried Crispy Chicken 2 Front

I created this Generic Customise Fried Crispy Chicken 2 Front Window Cling for convenience, corner stores and gas stations that sell chicken to their customers. I used the Mister Earl font with a shadow to give the design some down home character. I will be adding several smaller sizes of this design to my Convenience Corner Store Banners & Signs collection. That way you don't have to play with the sizing.

Customer Reviews

3.6 out of 5 stars rating199 Total Reviews
117 total 5-star reviews11 total 4-star reviews7 total 3-star reviews10 total 2-star reviews54 total 1-star reviews
199 Reviews
Reviews for similar products
5 out of 5 stars rating
By Evgeny P.6 November 2025Verified Purchase
Style: Automatic Opaque Design: White Underbase, Shape: Rectangle, Display: Back of Cling, Window Cling
Creator Review
Went out stylish. The cut lines are thin, and extra light definitely helps when cutting. Love the end result!
from zazzle.com (US)
5 out of 5 stars rating
By PCS I.3 October 2025Verified Purchase
Style: Opaque Design: All-over White Underbase, Shape: Rectangle, Display: Back of Cling, Window Cling
Wow these are great. Great quality, great price, and great look ! The "cling" works great, put these up weeks ago and they still are "clung" with no issues whatsoever!! We'll done! A+.
from zazzle.com (US)
1 out of 5 stars rating
By Anonymous6 September 2024Verified Purchase
Style: Automatic Opaque Design: White Underbase, Shape: Rectangle, Display: Back of Cling, Window Cling
This is RIDICULOUS! Extremely poor quality. And to think I had to wait even longer to receive my order because was delayed. Not happy at all with this order.
from zazzle.com (US)

Tags

Window Clings
chicken front window clinggenericcustomisefriedcrispychickensignpersonalise fried chicken sign
All Products
chicken front window clinggenericcustomisefriedcrispychickensignpersonalise fried chicken sign

Other Info

Product ID: 256233626856456749
Posted on 22/06/2022, 10:11 AM
Rating: G