Tap / click on image to see more RealViewsTM
$41.05
per roll
 

Giftwrap: Jolly Santa Wrapping Paper

Qty:

Other designs from this category

About Wrapping Paper

Sold by

Paper Finish: Matte Wrapping Paper

Make sure every gift you give has a layer of love by creating custom wrapping paper. Available in four types of premium paper and five different sizes, our wrapping paper covers all your gift wrapping needs - because presentation matters as much as the gift!

  • 64lb print quality matte paper
  • Ideal for printing photos
  • Full colour edge-to-edge printing
  • Width: 74 cm
  • Length: multiple options from 1.8 m to 18.3 m
  • Each roll up to 4.6 m in length; lengths greater than 4.6 m shipped as multiple 4.6 m rolls
  • Length guide:
    • 1.8 m roll wraps 3 shirt-sized boxes
    • 4.6 m roll wraps 9 shirt-sized boxes
    • 9.1 m roll wraps 18 shirt-sized boxes
    • 13.7 m roll wraps 27 shirt-sized boxes
    • 18.3 m roll wraps 36 shirt-sized boxes
  • Designable area is 91 x 76 cm, but scaled down uniformly and printed at 88.4 x 73.7 cm
  • Please note: Designs are tiled after first 88.4 x 73.7 cm printed section

About This Design

Giftwrap:  Jolly Santa Wrapping Paper

Giftwrap: Jolly Santa Wrapping Paper

This giftwrap was designed with free public domain vintage artwork.

Customer Reviews

4.7 out of 5 stars rating4.1K Total Reviews
3384 total 5-star reviews377 total 4-star reviews114 total 3-star reviews73 total 2-star reviews107 total 1-star reviews
4,055 Reviews
Reviews for similar products
5 out of 5 stars rating
By P.12 November 2023Verified Purchase
Wrapping Paper, Matte Wrapping Paper
Zazzle Reviewer Program
Quality paper and ribbons. To personalise took no longer and I will be so excited to see the grandchildren’s faces on Christmas day that I took the time to help this day be memorable. Clear and precise on quality matt paper that looks modern and memorable.
5 out of 5 stars rating
By Anonymous10 March 2025Verified Purchase
Wrapping Paper, Matte Wrapping Paper
My husband was super impressed with the personalized wrap.
5 out of 5 stars rating
By Audrey W.20 May 2022Verified Purchase
Wrapping Paper, Matte Wrapping Paper
Zazzle Reviewer Program
very happy with the paper, excellant service. excellant very cute with the colourful bee's

Tags

Wrapping Paper
santajollychristmasxmasvchdgiftwrapwrappaperwrapping
All Products
santajollychristmasxmasvchdgiftwrapwrappaperwrapping

Other Info

Product ID: 256561890783440174
Posted on 21/08/2018, 3:17 PM
Rating: G