Tap / click on image to see more RealViewsTM
$54.90
per plaque
 

Glitch: achievement commuter mug plaque

Qty:
  1. Size

Other designs from this category

About Plaques

Sold by

Size: 13.3 × 13.3 cm

For a professional display without a frame get a custom display plaque! Printed with a dye-sublimation process, your image colours are transferred directly onto the hardboard panel for a stunningly crisp finish. Protected with a UV-resistant gloss, your plaque will resist scratches and fading for years to come.

  • Dimensions: 13.3 cm x 13.3 cm
  • Hardboard panel with UV-resistant coating
  • Includes a repositionable and attachable easel stand
  • Easy wipe-clean surface
Designer tip: To ensure the highest quality print, please note that this product’s customisable design area measures 13.3 cm x 13.3 cm. For best results please add 3 mm bleed.

About This Design

Glitch: achievement commuter mug plaque

Glitch: achievement commuter mug plaque

Glitch: achievement commuter mug This Glitch product is brought to you by the Vac of Wetdryvac.net, who is most thankful to the folks of GlitchTheGame.com and TinySpeck.com for releasing their entire body of artwork into the public domain. The Vac's plan is to convert and release as much of that artwork on Zazzle as it has the brain space for, to be shared with the Glitch community - a whole lot of seriously awesome folks who helped make the game as lovely as it was - any anyone else who fancies some excellent art printed on various products. Most of these products are converted from the original .fla files to .png with transparency at 4000x4000 pixels. If you’d like to go nab the source material yourself, you can do so here: http://www.glitchthegame.com/ Glitch, Glitchen, the vac misses you all!

Customer Reviews

4.8 out of 5 stars rating1.3K Total Reviews
1147 total 5-star reviews72 total 4-star reviews13 total 3-star reviews10 total 2-star reviews28 total 1-star reviews
1,270 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Lisa L.25 December 2021Verified Purchase
13.3 × 13.3 cm
Zazzle Reviewer Program
Was as expected and imagine nice and clear. Printing and picture were both really good
5.0 out of 5 stars rating
5 out of 5 stars rating
By Ana L.3 January 2021Verified Purchase
13.3 × 13.3 cm
Zazzle Reviewer Program
EXCELLENT value for the money. I customized a favorite local beach photo by adding a message to the photo. Will be used as a hostess gift for an upcoming celebration. The photo is one the hostess took. I ordered another one for myself. Can see many opportunities in the year ahead for more customized photos. The design and construction of the frame is very sturdy and the high gloss on the photo gives it a very finished, professional look. PERFECT. Would not change a thing.
from zazzle.com (US)
5.0 out of 5 stars rating
5 out of 5 stars rating
By Randolph P.15 August 2023Verified Purchase
13.3 × 13.3 cm
Zazzle Reviewer Program
My 2-year old GSD Vito was recently neutered/teeth cleaned and I wanted to give his Vet a little something to show my appreciation. I really like l’d the design and ability to personalize the frame. It came out beautifully! Thank you Judy! The printing was very nice; looked great!
from zazzle.com (US)

Tags

achievementcommutermugglitchglitchenwetdryvactinyspeckglitchthegame

Other Info

Product ID: 200565200414213162
Posted on 7/10/2014, 12:42 PM
Rating: G