Tap / click on image to see more RealViewsTM
Sale Price $49.69.  
Original Price $58.45 per shirt
You save 15%

Glitch: achievement curious george T-Shirt

Qty:
  1. Size

  2. Style

  3. Colour & Print Process: Black

    Classic Printing: No Underbase
    Vivid Printing: White Underbase

Other designs from this category

About T-Shirts

Sold by

Style: Women's Basic T-Shirt

This basic t-shirt features a relaxed fit for the female shape. Made from 100% cotton, this t-shirt is both durable and soft – a great combination if you're looking for that casual wardrobe staple. Select a design from our marketplace or customise it and unleash your creativity!

Size & Fit

  • Model is 5'7"/170 cm and is wearing a Small
  • Standard fit
  • Fits true to size

Fabric & Care

  • 100% cotton
  • Tagless label for comfort
  • Double-needle hemmed sleeves and bottom
  • Machine wash cold
  • Imported

About This Design

Glitch: achievement curious george T-Shirt

Glitch: achievement curious george T-Shirt

Glitch: achievement curious george This Glitch product is brought to you by the Vac of Wetdryvac.net, who is most thankful to the folks of GlitchTheGame.com and TinySpeck.com for releasing their entire body of artwork into the public domain. The Vac's plan is to convert and release as much of that artwork on Zazzle as it has the brain space for, to be shared with the Glitch community - a whole lot of seriously awesome folks who helped make the game as lovely as it was - any anyone else who fancies some excellent art printed on various products. Most of these products are converted from the original .fla files to .png with transparency at 4000x4000 pixels. If you’d like to go nab the source material yourself, you can do so here: http://www.glitchthegame.com/ Glitch, Glitchen, the vac misses you all!

Customer Reviews

4.5 out of 5 stars rating15K Total Reviews
10656 total 5-star reviews2874 total 4-star reviews838 total 3-star reviews400 total 2-star reviews268 total 1-star reviews
15,036 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Haley31 March 2024Verified Purchase
My Clan Graham is high quality garment and its history even more important, Clan Graham fought for the right to wear kilts and won. Clan Graham, Duke of Montrose are advisors to China on renewable energy. Heavy duty Cotton. The design and colours are superb, I feel very proud as a Graham descendant from Appleby Westmorland Cumbria to wear this especially when wearing of patches is banned in Aotoearoa - New Zealand. Kiwis wear all black as the t shirt is with Green lettering to match the environment and yellow for joy and purple thistle to match my hair. The wardrobe police know who my Clan is now !
Original product
5.0 out of 5 stars rating
5 out of 5 stars rating
By Merv11 June 2017Verified Purchase
Basic T-Shirt, White, Large
Zazzle Reviewer Program
The tee shirt was of good quality and the photo true to original. The printing was just fine, as usual.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Jenny S.11 July 2024Verified Purchase
Basic T-Shirt, Black, XL
Creator Review
Comfortable fit and well made shirt. . I was really impressed with how well the print came out considering it was from a photo of my original art work. Appears to wash well so far too.

Tags

T-Shirts
achievementcuriousgeorgeglitchglitchenwetdryvactinyspeckglitchthegame
All Products
achievementcuriousgeorgeglitchglitchenwetdryvactinyspeckglitchthegame

Other Info

Product ID: 235424801630779165
Posted on 7/10/2014, 12:51 PM
Rating: G