Sell on Zazzle
Tap / click on image to see more RealViewsTM
$71.40
per roll
 

Glitch: achievement curious george wrapping paper

4.7 out of 5 stars rating
3933 Total Reviews |
by
Qty:

Other designs from this category

About Wrapping Paper

Sold by
Wrapping Paper
Create your own from scratch

Paper Finish: Glossy Wrapping Paper

Make sure every gift you give has a layer of love by creating custom wrapping paper. Available in four types of premium paper and five different sizes, our wrapping paper covers all your gift wrapping needs - because presentation matters as much as the gift!

  • 64lb print quality glossy paper
  • Ideal for printing photos
  • Full colour edge-to-edge printing
  • Width: 74 cm
  • Length: multiple options from 1.8 m to 18.3 m
  • Each roll up to 4.6 m in length; lengths greater than 4.6 m shipped as multiple 4.6 m rolls
  • Length guide:
    • 1.8 m roll wraps 3 shirt-sized boxes
    • 4.6 m roll wraps 9 shirt-sized boxes
    • 9.1 m roll wraps 18 shirt-sized boxes
    • 13.7 m roll wraps 27 shirt-sized boxes
    • 18.3 m roll wraps 36 shirt-sized boxes
  • Designable area is 91 x 76 cm, but scaled down uniformly and printed at 88.4 x 73.7 cm
  • Please note: Designs are tiled after first 88.4 x 73.7 cm printed section

About This Design

Glitch: achievement curious george wrapping paper

Glitch: achievement curious george wrapping paper

Glitch: achievement curious george This Glitch product is brought to you by the Vac of Wetdryvac.net, who is most thankful to the folks of GlitchTheGame.com and TinySpeck.com for releasing their entire body of artwork into the public domain. The Vac's plan is to convert and release as much of that artwork on Zazzle as it has the brain space for, to be shared with the Glitch community - a whole lot of seriously awesome folks who helped make the game as lovely as it was - any anyone else who fancies some excellent art printed on various products. Most of these products are converted from the original .fla files to .png with transparency at 4000x4000 pixels. If you’d like to go nab the source material yourself, you can do so here: http://www.glitchthegame.com/ Glitch, Glitchen, the vac misses you all!
GlitchenIn
Pro
Artwork designed by
View their Store

Customer Reviews

4.7 out of 5 stars rating3.9K Total Reviews
3304 total 5-star reviews374 total 4-star reviews109 total 3-star reviews65 total 2-star reviews81 total 1-star reviews
3,933 Reviews
Reviews for similar products
5 out of 5 stars rating
By P.12 November 2023 • Verified Purchase
Wrapping Paper, Matte Wrapping Paper
Zazzle Reviewer Program
Quality paper and ribbons. To personalise took no longer and I will be so excited to see the grandchildren’s faces on Christmas day that I took the time to help this day be memorable. Clear and precise on quality matt paper that looks modern and memorable.
5 out of 5 stars rating
By Anonymous10 March 2025 • Verified Purchase
Wrapping Paper, Matte Wrapping Paper
My husband was super impressed with the personalized wrap.
5 out of 5 stars rating
By Audrey W.20 May 2022 • Verified Purchase
Wrapping Paper, Matte Wrapping Paper
Zazzle Reviewer Program
very happy with the paper, excellant service. excellant very cute with the colourful bee's

Tags

Wrapping Paper
achievementcuriousgeorgeglitchglitchenwetdryvactinyspeckglitchthegame
All Products
achievementcuriousgeorgeglitchglitchenwetdryvactinyspeckglitchthegame

Other Info

Product ID: 256511350431932487
Posted on 7/10/2014, 12:51 PM
Rating: G