Tap / click on image to see more RealViewsTM
$77.50
per bag
 

Glitch: achievement epic urian large tote bag

Qty:
Jumbo Tote
+$18.60
-$22.20
-$40.60
-$3.60
Natural
+$14.85
+$14.85

Other designs from this category

About Bags

Sold by

Style: Jumbo Tote

Design your own tote bag to carry your belongings in style! Available in multiple sizes to suit all your carrying needs, these bags are made of 100% natural material and can be customised with your favourite pictures and text for the perfect gift or casual accessory. Versatile, trendy, and durable, this custom tote means you'll always look fashionable!

  • Dimensions: 36.8cm (L) x 50.8cm (W); 10.2cm deep
  • Material: 100% cotton
  • Squared bottom, perfect for groceries and larger items
  • Extra-long cotton web handles with stress-point reinforced stitching
  • Print on both sides for a small additional charge
  • Recommended care instructions: Hand wash cold. Do not bleach. Lay flat to dry. Do not iron.

About This Design

Glitch: achievement epic urian large tote bag

Glitch: achievement epic urian large tote bag

Glitch: achievement epic urian This Glitch product is brought to you by the Vac of Wetdryvac.net, who is most thankful to the folks of GlitchTheGame.com and TinySpeck.com for releasing their entire body of artwork into the public domain. The Vac's plan is to convert and release as much of that artwork on Zazzle as it has the brain space for, to be shared with the Glitch community - a whole lot of seriously awesome folks who helped make the game as lovely as it was - any anyone else who fancies some excellent art printed on various products. Most of these products are converted from the original .fla files to .png with transparency at 4000x4000 pixels. If you’d like to go nab the source material yourself, you can do so here: http://www.glitchthegame.com/ Glitch, Glitchen, the vac misses you all!

Customer Reviews

4.6 out of 5 stars rating6.8K Total Reviews
5160 total 5-star reviews1108 total 4-star reviews315 total 3-star reviews124 total 2-star reviews92 total 1-star reviews
6,799 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Patty S.27 July 2023Verified Purchase
Budget Tote
Zazzle Reviewer Program
I ordered this tote for a birthday gift for a very good friend and filled it full of items she would enjoy. She absolute loved it! The monogram and flowers were beautiful and the bag itself was good sized and strong. She was thrilled with the tote bag! I would definitely recommend this item. It was a decent price and it didn’t take long for delivery. I would without a doubt order another one in the future. The letter I requested was perfect, as well as the color of it, and the floral decor was done beautifully!
from zazzle.com (US)
5.0 out of 5 stars rating
5 out of 5 stars rating
By Kit C.12 May 2021Verified Purchase
Budget Tote
Zazzle Reviewer Program
I'm in charge of Teacher & Staff Appreciation for our Elementary school. I came across these bags and thought they were so cute and would be perfect for the teachers and staff...78 total. The turn around time was less than 1 week! They turned out darling! We got the jumbo size and it will be perfect for taking things to and from school...thank you so much!!! The printing was crisp and perfect!
from zazzle.com (US)
5.0 out of 5 stars rating
5 out of 5 stars rating
By chris v.19 October 2019Verified Purchase
Impulse Tote
Zazzle Reviewer Program
Great Quality! Is a gift for a teacher friend to be her "teacher bag" as she calls it! Looks like it will last a while! Exactly as I printed it! Looks amazing!!
from zazzle.com (US)

Tags

Bags
achievementepicurianglitchglitchenwetdryvactinyspeckglitchthegame
All Products
achievementepicurianglitchglitchenwetdryvactinyspeckglitchthegame

Other Info

Product ID: 149160798136599712
Posted on 12/10/2014, 10:30 AM
Rating: G