Tap / click on image to see more RealViewsTM
$62.55
per ornament
 

Glitch: achievement first mab emblem metal tree decoration

Qty:
Premium Round Ornament
-$21.25
-$21.25
-$13.30
-$13.30
-$21.25
-$23.95
-$23.95
-$23.95
-$15.95
-$15.95
-$15.95

Other designs from this category

About Ornaments

Sold by

Style: Premium Round Ornament

Capture wonderful family memories in a beautiful holiday keepsake with this premium round Christmas tree decoration. You can upload photos of your children, or your whole family, and send them out as holiday gifts.

  • Dimensions:
    • Diameter: 5.4 cm
    • Weight: 35.4 g.
  • Silver coloured metal tree decoration
  • Full-colour, full-bleed printing
  • UV Resistant and Waterproof
  • Creator Tip: To ensure the highest quality print, please note that this product's customisable design area measures 4.95 cm x 4.95 cm. For best results please add 0.15 cm (.12") bleed.

About This Design

Glitch: achievement first mab emblem metal tree decoration

Glitch: achievement first mab emblem metal tree decoration

Glitch: achievement first mab emblem This Glitch product is brought to you by the Vac of Wetdryvac.net, who is most thankful to the folks of GlitchTheGame.com and TinySpeck.com for releasing their entire body of artwork into the public domain. The Vac's plan is to convert and release as much of that artwork on Zazzle as it has the brain space for, to be shared with the Glitch community - a whole lot of seriously awesome folks who helped make the game as lovely as it was - any anyone else who fancies some excellent art printed on various products. Most of these products are converted from the original .fla files to .png with transparency at 4000x4000 pixels. If you’d like to go nab the source material yourself, you can do so here: http://www.glitchthegame.com/ Glitch, Glitchen, the vac misses you all!

Customer Reviews

4.7 out of 5 stars rating11.6K Total Reviews
9473 total 5-star reviews1283 total 4-star reviews374 total 3-star reviews174 total 2-star reviews287 total 1-star reviews
11,591 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Nicole M.3 December 2020Verified Purchase
Premium Round Ornament
Zazzle Reviewer Program
What a cute ornament with all the best bosses from Mega Man 1-4! The coating (to keep from scratching) almost feels like podge glue. Awesome! Very awesome - see my photo for size.
from zazzle.com (US)
5.0 out of 5 stars rating
5 out of 5 stars rating
By Shirley T.21 January 2021Verified Purchase
Premium Round Ornament
Zazzle Reviewer Program
I never thought about collecting Christmas Ornaments for each place my husband & I traveled until later on in our lives. Now I'm trying to play catch up with all the places we've traveled to & didn't have an ornament. I made a travel tree this year that I will keep up all year in my office, since the majority of the ornaments are places from all around the world where our company has taken us to. Print was large enough to see.
from zazzle.com (US)
5.0 out of 5 stars rating
5 out of 5 stars rating
By Audri G.4 December 2020Verified Purchase
Ceramic Circle Ornament
Zazzle Reviewer Program
We wanted an elegant looking ornament to add to our family Christmas tree and we were very excited to see we were given the option to upgrade to this one as we customized the art work. We loved it, the product is very well made. I knew the product would be elegant but was pleasantly surprised at the weight of the item and that it came in a protective pouch we can use to store.
from zazzle.com (US)

Tags

Ornaments
achievementfirstmabemblemglitchglitchenwetdryvactinyspeckglitchthegame
All Products
achievementfirstmabemblemglitchglitchenwetdryvactinyspeckglitchthegame

Other Info

Product ID: 175399602482235531
Posted on 13/10/2014, 12:51 PM
Rating: G