Tap / click on image to see more RealViewsTM
Sale Price $43.95.  
Original Price $51.70 per shirt
You save 15%

Glitch: achievement five feat under T-Shirt

Qty:
Kids Basic T-Shirt
+$20.45
+$40.00
+$40.00
Black
Classic Printing: No Underbase
-$11.55
-$6.90
-$11.55
-$6.90
-$6.90
-$6.90
-$6.90
-$6.90
Vivid Printing: White Underbase

Other designs from this category

About T-Shirts

Sold by

Style: Kids' Basic T-Shirt

Wait 'till you get this tee on your kiddo, it'll take his everyday style to a whole new level--especially when you customise it with your own design.

Size & Fit

  • Model is 135 cm and is wearing a medium
  • Garment is unisex sizing
  • Standard fit
  • True to size

Fabric & Care

  • 6.0 oz.,/203 gsm, pre-shrunk 100% ComfortSoft® cotton; Oxford Green is 60/40
  • Shoulder-to-shoulder taping with coverstitched collar
  • Double-needle stitched armholes and sleeves
  • Imported
  • Machine wash cold

About This Design

Glitch: achievement five feat under T-Shirt

Glitch: achievement five feat under T-Shirt

Glitch: achievement five feat under This Glitch product is brought to you by the Vac of Wetdryvac.net, who is most thankful to the folks of GlitchTheGame.com and TinySpeck.com for releasing their entire body of artwork into the public domain. The Vac's plan is to convert and release as much of that artwork on Zazzle as it has the brain space for, to be shared with the Glitch community - a whole lot of seriously awesome folks who helped make the game as lovely as it was - any anyone else who fancies some excellent art printed on various products. Most of these products are converted from the original .fla files to .png with transparency at 4000x4000 pixels. If you’d like to go nab the source material yourself, you can do so here: http://www.glitchthegame.com/ Glitch, Glitchen, the vac misses you all!

Customer Reviews

4.7 out of 5 stars rating1.9K Total Reviews
1472 total 5-star reviews279 total 4-star reviews78 total 3-star reviews29 total 2-star reviews29 total 1-star reviews
1,887 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Anonymous9 July 2026Verified Purchase
Kids Basic T-Shirt, Black, Youth XS
Lovely tee shirt thanks - Zazzle really is a great company. This is my second order and I’m so impressed. .
5.0 out of 5 stars rating
5 out of 5 stars rating
By B.31 March 2023Verified Purchase
Kids Basic T-Shirt, Black, Youth XS
Zazzle Reviewer Program
Perfect for a little boy dealing with school and becoming a big brother. He loves gaming with his dad so was awesome. Great. No flaws or anything different from what was advertised. Very happy little guy.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Smith T.17 June 2020Verified Purchase
Kids Basic T-Shirt, Black, Youth M
Zazzle Reviewer Program
The t-shirt feels and looks great quality, a good thick cotton. It will be a little big for my son, but that means he will be able to wear it and not out grow it too soon. The print was as described on the order when personalised. True size, shape and colour T-shirt- thanks.

Tags

T-Shirts
achievementfivefeatunderglitchglitchenwetdryvactinyspeckglitchthegame
All Products
achievementfivefeatunderglitchglitchenwetdryvactinyspeckglitchthegame

Other Info

Product ID: 235106775743443390
Posted on 13/10/2014, 12:56 PM
Rating: G