Tap / click on image to see more RealViewsTM
$58.45
per shirt
 

Glitch: achievement forgey laforge T-Shirt

Qty:
Basic T-Shirt
+$18.35
+$45.60
+$20.00
Black
Classic Printing: No Underbase
-$11.55
-$11.55
-$11.55
-$11.55
-$11.55
Vivid Printing: White Underbase

Other designs from this category

About T-Shirts

Sold by

Style: Women's Basic T-Shirt

This basic t-shirt features a relaxed fit for the female shape. Made from 100% cotton, this t-shirt is both durable and soft – a great combination if you're looking for that casual wardrobe staple. Select a design from our marketplace or customise it and unleash your creativity!

Size & Fit

  • Model is 5'7"/170 cm and is wearing a Small
  • Standard fit
  • Fits true to size

Fabric & Care

  • 100% cotton
  • Tagless label for comfort
  • Double-needle hemmed sleeves and bottom
  • Machine wash cold
  • Imported

About This Design

Glitch: achievement forgey laforge T-Shirt

Glitch: achievement forgey laforge T-Shirt

Glitch: achievement forgey laforge This Glitch product is brought to you by the Vac of Wetdryvac.net, who is most thankful to the folks of GlitchTheGame.com and TinySpeck.com for releasing their entire body of artwork into the public domain. The Vac's plan is to convert and release as much of that artwork on Zazzle as it has the brain space for, to be shared with the Glitch community - a whole lot of seriously awesome folks who helped make the game as lovely as it was - any anyone else who fancies some excellent art printed on various products. Most of these products are converted from the original .fla files to .png with transparency at 4000x4000 pixels. If you’d like to go nab the source material yourself, you can do so here: http://www.glitchthegame.com/ Glitch, Glitchen, the vac misses you all!

Customer Reviews

4.5 out of 5 stars rating15K Total Reviews
10626 total 5-star reviews2870 total 4-star reviews832 total 3-star reviews390 total 2-star reviews262 total 1-star reviews
14,980 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By H.31 March 2024Verified Purchase
My Clan Graham is high quality garment and its history even more important, Clan Graham fought for the right to wear kilts and won. Clan Graham, Duke of Montrose are advisors to China on renewable energy. Heavy duty Cotton. The design and colours are superb, I feel very proud as a Graham descendant from Appleby Westmorland Cumbria to wear this especially when wearing of patches is banned in Aotoearoa - New Zealand. Kiwis wear all black as the t shirt is with Green lettering to match the environment and yellow for joy and purple thistle to match my hair. The wardrobe police know who my Clan is now !
Original product
5.0 out of 5 stars rating
5 out of 5 stars rating
By M.11 June 2017Verified Purchase
Basic T-Shirt, White, Adult L
Zazzle Reviewer Program
The tee shirt was of good quality and the photo true to original. The printing was just fine, as usual.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Chris T.7 January 2022Verified Purchase
Basic T-Shirt, Pale Pink, Adult L
Zazzle Reviewer Program
I loved the T-shirt, it is exactly as I designed with changes, the right size and colours, and I am awed at the speed of delivery to NZ in 17 days right before Christmas, thank you so much. My sister loved it! I chose an existing design and added one or two personal details. Adding elements was very easy and straightforward, choosing colours was easy. The colours were perfect, all the right size and style lettering

Tags

T-Shirts
achievementforgeylaforgeglitchglitchenwetdryvactinyspeckglitchthegame
All Products
achievementforgeylaforgeglitchglitchenwetdryvactinyspeckglitchthegame

Other Info

Product ID: 235881824069749665
Posted on 13/10/2014, 1:05 PM
Rating: G