Tap / click on image to see more RealViewsTM
$10.35
per magnet
 

Glitch: achievement good bubble farmer magnet

Qty:
Circle
+$3.90
+$1.80
Small, 3.2 Cm
+$1.80
+$3.45

Other designs from this category

About Magnets

Sold by

Shape: Circle

Give your fridge a personality upgrade. Upload a photo, design, or logo and turn it into a magnet that actually looks good up there.

  • Available in 3 sizes: 3.2 cm, 5.7 cm, and 7.6 cm diameter
  • USA-made with recycled domestic steel
  • Smooth glossy mylar finish, scratch and UV-resistant
  • Printed on FSC-certified recycled paper
  • Standard fridge-strength magnet
  • Also available in square or rectangle

About This Design

Glitch: achievement good bubble farmer magnet

Glitch: achievement good bubble farmer magnet

Glitch: achievement good bubble farmer This Glitch product is brought to you by the Vac of Wetdryvac.net, who is most thankful to the folks of GlitchTheGame.com and TinySpeck.com for releasing their entire body of artwork into the public domain. The Vac's plan is to convert and release as much of that artwork on Zazzle as it has the brain space for, to be shared with the Glitch community - a whole lot of seriously awesome folks who helped make the game as lovely as it was - any anyone else who fancies some excellent art printed on various products. Most of these products are converted from the original .fla files to .png with transparency at 4000x4000 pixels. If you’d like to go nab the source material yourself, you can do so here: http://www.glitchthegame.com/ Glitch, Glitchen, the vac misses you all!

Customer Reviews

4.8 out of 5 stars rating6.9K Total Reviews
6160 total 5-star reviews572 total 4-star reviews119 total 3-star reviews46 total 2-star reviews40 total 1-star reviews
6,937 Reviews
Reviews for similar products
5 out of 5 stars rating
By Michelle H.4 July 2023Verified Purchase
Magnet, Style: Circle, Size: Large, 7.6 Cm
Zazzle Reviewer Program
Great size, designed it all online and it was exactly as I designed it. Great sharp and clear image Arrived very quickly. I wished the photo was slightly brighter however this is how it was on the website when designing so it’s true to the design
5 out of 5 stars rating
By Dennis P.24 May 2023Verified Purchase
Magnet, Style: Circle, Size: Standard, 5.7 Cm
Zazzle Reviewer Program
I love it. The antique look awesome. A friend thought I'd had for years. 👍. Excellent writing and is very clear and sharp. 👍👌👍
5 out of 5 stars rating
By Paula H.10 July 2022Verified Purchase
Magnet, Style: Circle, Size: Large, 7.6 Cm
Zazzle Reviewer Program
High quality!!!!!!!!!! Brilliant design!!!!!!

Tags

Magnets
achievementgoodbubblefarmerglitchglitchenwetdryvactinyspeckglitchthegame
All Products
achievementgoodbubblefarmerglitchglitchenwetdryvactinyspeckglitchthegame

Other Info

Product ID: 147376078649865790
Posted on 21/10/2014, 6:28 PM
Rating: G