Tap / click on image to see more RealViewsTM
$22.95
per keychain
 

Glitch: achievement hero cubimals key ring

Qty:
Aluminum Circle
+$6.00
+$6.00
+$29.35
+$29.35

Other designs from this category

About Keychains

About This Design

Glitch: achievement hero cubimals key ring

Glitch: achievement hero cubimals key ring

Glitch: achievement hero cubimals This Glitch product is brought to you by the Vac of Wetdryvac.net, who is most thankful to the folks of GlitchTheGame.com and TinySpeck.com for releasing their entire body of artwork into the public domain. The Vac's plan is to convert and release as much of that artwork on Zazzle as it has the brain space for, to be shared with the Glitch community - a whole lot of seriously awesome folks who helped make the game as lovely as it was - any anyone else who fancies some excellent art printed on various products. Most of these products are converted from the original .fla files to .png with transparency at 4000x4000 pixels. If you’d like to go nab the source material yourself, you can do so here: http://www.glitchthegame.com/ Glitch, Glitchen, the vac misses you all!

Customer Reviews

4.6 out of 5 stars rating5.4K Total Reviews
4227 total 5-star reviews783 total 4-star reviews217 total 3-star reviews117 total 2-star reviews102 total 1-star reviews
5,446 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Ali Y.4 February 2026Verified Purchase
Metal Circle Keychain, 5.08 cm
Lovely & cute keychains i love them thank you sooo much ,they also reached to me soo fast 😍.
from zazzle.com (US)
5.0 out of 5 stars rating
5 out of 5 stars rating
By Christina J.11 March 2024Verified Purchase
Premium Round Keychain, Large (5.397 cm)
These are a durable metal and the colors are vibrant. One of the clasp came broken but received a new one quickly. Customer service was responsive and quick to resolve the issue. They are bigger than I thought but still work for my wedding. I am satisfied with the print quality and surprised at how vibrant the colors are.
from zazzle.com (US)
5.0 out of 5 stars rating
5 out of 5 stars rating
By V.21 August 2023Verified Purchase
Zazzle Reviewer Program
Beyond expectations. Choice of artwork is overwhelming, I found exactly what I needed from SJW_Graphics. Detail, colors, overall design looks great on this keyring. Could use as a pendant, purse charm, bookmark, too! Metal is sturdy without being heavy. Colors beautiful, with clear margins. Customized name makes this gift extra special. So many fonts, so many colors & sizes!
from zazzle.com (US)
Original product

Tags

Keychains
achievementherocubimalsglitchglitchenwetdryvactinyspeckglitchthegame
All Products
achievementherocubimalsglitchglitchenwetdryvactinyspeckglitchthegame

Other Info

Product ID: 146528940696249206
Posted on 22/10/2014, 12:39 PM
Rating: G