Tap / click on image to see more RealViewsTM
$239.00
per dartboard
 

Glitch: achievement homesteader dartboard

Qty:
Heads-up!
Sorry, this product is completely sold out.

Other designs from this category

About Dartboards

Sold by

Size: ProfiledInk Dart Board

Bull's-eye! Create the perfect custom dart board. Featuring vibrant colour printing, this regulation size dart board is easily customised with your images, text and designs for a great gift or the perfect addition to your game room. Made to your exact specifications, this dart board will hit its mark!

  • Dimensions: 45.7 cm diameter, 2.5 cm h; regulation size board
  • Includes 6 brass darts (3 American flag dart flights and 3 UK dart flights)
  • Vibrant, full-colour printing
  • Finished with aluminium frame and hanging hook

This product is recommended for ages 14+..
Creator Tip: To ensure the highest quality print, please note that this product's customisable design area measures 44.4 cm x 444 cm.

About This Design

Glitch: achievement homesteader dartboard

Glitch: achievement homesteader dartboard

Glitch: achievement homesteader This Glitch product is brought to you by the Vac of Wetdryvac.net, who is most thankful to the folks of GlitchTheGame.com and TinySpeck.com for releasing their entire body of artwork into the public domain. The Vac's plan is to convert and release as much of that artwork on Zazzle as it has the brain space for, to be shared with the Glitch community - a whole lot of seriously awesome folks who helped make the game as lovely as it was - any anyone else who fancies some excellent art printed on various products. Most of these products are converted from the original .fla files to .png with transparency at 4000x4000 pixels. If you’d like to go nab the source material yourself, you can do so here: http://www.glitchthegame.com/ Glitch, Glitchen, the vac misses you all!

Customer Reviews

4.6 out of 5 stars rating139 Total Reviews
109 total 5-star reviews13 total 4-star reviews9 total 3-star reviews4 total 2-star reviews4 total 1-star reviews
139 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Angeline H.11 August 2023Verified Purchase
Metal Cage Dartboard
Zazzle Reviewer Program
Was exactly what I wanted for his retirement gift. I knew that the quality of the image wasn't the best but it turned out to be awesome
5.0 out of 5 stars rating
5 out of 5 stars rating
By Kim d.17 December 2022Verified Purchase
Metal Cage Dartboard
Zazzle Reviewer Program
I am so please with the quality of this dartboard and the image is awesome!! My son was in the MC and I can't wait to give this to him for Christmas! The printing is perfect!
from zazzle.com (US)
5.0 out of 5 stars rating
5 out of 5 stars rating
By Pamela A.11 July 2019Verified Purchase
Metal Cage Dartboard
Zazzle Reviewer Program
It was honestly way better than I expected. Gorgeous, looked just like I designed.
from zazzle.com (US)

Tags

Dartboards
achievementhomesteaderglitchglitchenwetdryvactinyspeckglitchthegame
All Products
achievementhomesteaderglitchglitchenwetdryvactinyspeckglitchthegame

Other Info

Product ID: 256221276966879902
Posted on 22/10/2014, 1:24 PM
Rating: G