Tap / click on image to see more RealViewsTM
$107.00
per case
 

Glitch: achievement licenced teleporter whoa class Case-Mate iPhone case

Qty:
Tough
-$14.15

Other designs from this category

About Casemate Cases

Sold by

Style: Case-Mate Tough Apple iPhone 11 Case

Simple, but tough. Contoured to fit the sleek curves of the iPhone, this Case-Mate case features a hard shell plastic exterior and shock absorbing liner to protect your device.

  • Designed for the Apple iPhone 11
  • Shock absorbing flexible liner for an added layer of protection
  • Impact resistant, durable hard plastic
  • Case will not interfere with wireless charging
  • Lay-flat bezel to protect your screen from directly contacting surfaces
  • Access to all ports, controls & sensors
  • Customise with your images, designs and text
  • Glossy finish
  • Printed in the USA

About This Design

Glitch: achievement licenced teleporter whoa class Case-Mate iPhone case

Glitch: achievement licenced teleporter whoa class Case-Mate iPhone case

Glitch: achievement licenced teleporter whoa class This Glitch product is brought to you by the Vac of Wetdryvac.net, who is most thankful to the folks of GlitchTheGame.com and TinySpeck.com for releasing their entire body of artwork into the public domain. The Vac's plan is to convert and release as much of that artwork on Zazzle as it has the brain space for, to be shared with the Glitch community - a whole lot of seriously awesome folks who helped make the game as lovely as it was - any anyone else who fancies some excellent art printed on various products. Most of these products are converted from the original .fla files to .png with transparency at 4000x4000 pixels. If you’d like to go nab the source material yourself, you can do so here: http://www.glitchthegame.com/ Glitch, Glitchen, the vac misses you all!

Customer Reviews

4.7 out of 5 stars rating6.5K Total Reviews
5235 total 5-star reviews839 total 4-star reviews210 total 3-star reviews118 total 2-star reviews125 total 1-star reviews
6,527 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Lawana H.29 January 2022Verified Purchase
Zazzle Reviewer Program
It was very nice the pictures were placed the way i put them. the printing was fine
from zazzle.com (US)
5.0 out of 5 stars rating
5 out of 5 stars rating
By Susan g.31 July 2025Verified Purchase
Case-Mate Phone Case, Apple iPhone 11, Tough
Creator Review
I purchased this waterfall photo case as a birthday gift. The design was created from one of my images, and my friend loved it. This case is well-suited for individuals who find the sight of flowing water to be calming, as he found the vision therapeutic. It proved to be a perfect gift for someone who already has everything.
from zazzle.com (US)
1.0 out of 5 stars rating
1 out of 5 stars rating
By Saingeline S.13 November 2020Verified Purchase
Case-Mate Phone Case, Apple iPhone 11, Barely There
Zazzle Reviewer Program
After having this phone case for 6 months, I had to come back and write a review and I will leave a review on the BBB (Better Business Bureau) website as well just in case it gets removed off this website. This phone case took nearly 2 months for me to receive it. It got lost in transit and Zazzle never reached out to me to tell me. After a month of waiting I called them to notify them that I have not received my case. That’s when they reordered another one; but I believe that if I had not called, they would’ve swept my purchase under the rug and never established a refund or replaced the item lost. After not even a month of having the phone case it cracked on the side and now having the case for only 6 months now the back of my phone is completely shattered. I am still paying on this phone and this expensive case that I paid over $30 for did not offer any protection to prevent my phone from shattering. I am here to warn others of purchasing from this company! This case is not what they make it seem. It doesn’t even fit completely around the phone, the top and bottom part of the phone isn’t covered by the case leaving space for it to get damaged. The case itself is very flimsy and the design is very flat. This item was not worth the price & I am very angry with this company and will never purchase from them again. Very poor printing! My phone case does not match or reflect the advertised picture, I thought the glitter would be more realistic. The art is very flat and this company should feel ashamed for the price they charge for this cheap case! I now have to go on Amazon and purchase another case that’ll actually look nice and be inexpensive while offering full shatter protection to my phone.
from zazzle.com (US)

Tags

Casemate Cases
achievementlicencedteleporterwhoaclassglitchglitchenwetdryvactinyspeckglitchthegame
All Products
achievementlicencedteleporterwhoaclassglitchglitchenwetdryvactinyspeckglitchthegame

Other Info

Product ID: 179869642484366722
Posted on 22/10/2014, 2:05 PM
Rating: G