Tap / click on image to see more RealViewsTM
$157.00
per poster
 

Glitch: achievement maniacal foxbrusher poster

Qty:
Choose Your Format
Custom (72.81cm x 72.81cm)
None

Other designs from this category

About Posters

Sold by

Paper Type: Value Poster Paper (Semi-Gloss)

Your walls are a reflection of your personality, so let them speak with your favorite quotes, art, or designs printed on our custom Giclee posters! High-quality, microporous resin-coated paper with a beautiful semi-gloss finish. Choose from standard or custom size posters and framing options to create art that’s a perfect representation of you.

  • Gallery quality Giclee prints
  • Ideal for vibrant artwork and photo reproduction
  • Semi-gloss finish
  • Pigment-based inks for full-color spectrum high-resolution printing
  • Durable 185gsm paper
  • Available in custom sizing up to 60”
  • Frames available on all standard sizes
  • Frames include Non-Glare Acrylic Glazing

About This Design

Glitch: achievement maniacal foxbrusher poster

Glitch: achievement maniacal foxbrusher poster

Glitch: achievement maniacal foxbrusher This Glitch product is brought to you by the Vac of Wetdryvac.net, who is most thankful to the folks of GlitchTheGame.com and TinySpeck.com for releasing their entire body of artwork into the public domain. The Vac's plan is to convert and release as much of that artwork on Zazzle as it has the brain space for, to be shared with the Glitch community - a whole lot of seriously awesome folks who helped make the game as lovely as it was - any anyone else who fancies some excellent art printed on various products. Most of these products are converted from the original .fla files to .png with transparency at 4000x4000 pixels. If you’d like to go nab the source material yourself, you can do so here: http://www.glitchthegame.com/ Glitch, Glitchen, the vac misses you all!

Customer Reviews

4.8 out of 5 stars rating14.4K Total Reviews
12363 total 5-star reviews1346 total 4-star reviews266 total 3-star reviews151 total 2-star reviews286 total 1-star reviews
14,412 Reviews
Reviews for similar products
5 out of 5 stars rating
By Donna Y.2 June 2022Verified Purchase
Print, Size: 60.96cm x 91.44cm, Media: Value Poster Paper (Semi-Gloss)
Zazzle Reviewer Program
I originally ordered this print in a larger size but was not pleased with the clarity of it. When I contacted Zazzle, they responded really quickly and were very helpful. I was able to reorder the print in a smaller size and it was shipped to me within a couple of weeks. The print was packaged well to ensure there was no damage during transit (Eco friendly, too!), and I am really pleased with it. I am so grateful to the customer service team for the professional way they handled my order. I had this printed on matt finish card and I was really pleased with the quality. The colours were rich and the image sharp.
5 out of 5 stars rating
By Mignon G.22 December 2021Verified Purchase
Print, Size: 41.91cm x 64.77cm, Media: Value Poster Paper (Semi-Gloss)
Zazzle Reviewer Program
Very happy with this product. No complaints.
5 out of 5 stars rating
By Vincent H.5 November 2024Verified Purchase
Print, Size: 121.92cm x 81.28cm, Media: Value Poster Paper (Semi-Gloss)
Arrived very fast, even three days early. Havent opened as i will wgive to my framer next week. But the team were amazing to deal with and i highly recomend based on that alone! Oh, and im from NZ. .

Tags

Posters
achievementmaniacalfoxbrusherglitchglitchenwetdryvactinyspeckglitchthegame
All Products
achievementmaniacalfoxbrusherglitchglitchenwetdryvactinyspeckglitchthegame

Other Info

Product ID: 228824825967469703
Posted on 23/10/2014, 8:58 AM
Rating: G