Tap / click on image to see more RealViewsTM
Sale Price $34.13.  
Original Price $40.15 per shirt
You save 15%

Glitch: artefact necklace amazonite baby bodysuit

Qty:
Baby Jersey Bodysuit
+$6.45
+$6.45
-$5.30
White
Classic Printing: No Underbase
Vivid Printing: White Underbase
+$6.95
+$6.95
+$6.95
+$6.95

Other designs from this category

About T-Shirts

Sold by

Style: Baby Jersey Bodysuit

Not all baby bodysuits are created equal – this popular style is a must-have for your precious little bundle. The neckband is designed for easy on-and-off and a three-snap closure makes diaper changes a cinch. Personalise it with a custom image or message or dress it up with a cute pair of socks and hat or hair accessory. There's no wrong way to wear this super soft bodysuit.

Size & Fit
  • Standard fit
  • Garment is unisex sizing
  • Flatlock seams, reinforced three snap closure
  • Fits true to size
Fabric & Care
  • 127g, 100% combed ring spun cotton (Heather is 93/7) jersey
  • Double-needle ribbed binding on all openings
  • EasyTear™ label
  • White is sewn with 100% cotton thread
  • Machine washable. Washing before first use is recommended
Fully committed to providing high quality and safe products, all Zazzle baby products are Consumer Product Safety Improvement Act (CPSIA) compliant. Tracking label available in side seam.

About This Design

Glitch: artefact necklace amazonite baby bodysuit

Glitch: artefact necklace amazonite baby bodysuit

Glitch: artefact necklace amazonite This Glitch product is brought to you by the Vac of Wetdryvac.net, who is most thankful to the folks of GlitchTheGame.com and TinySpeck.com for releasing their entire body of artwork into the public domain. The Vac's plan is to convert and release as much of that artwork on Zazzle as it has the brain space for, to be shared with the Glitch community - a whole lot of seriously awesome folks who helped make the game as lovely as it was - any anyone else who fancies some excellent art printed on various products. Most of these products are converted from the original .fla files to .png with transparency at 4000x4000 pixels. If you’d like to go nab the source material yourself, you can do so here: http://www.glitchthegame.com/ Glitch, Glitchen, the vac misses you all!

Customer Reviews

4.6 out of 5 stars rating2.5K Total Reviews
1937 total 5-star reviews406 total 4-star reviews103 total 3-star reviews48 total 2-star reviews40 total 1-star reviews
2,534 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Becky G.19 December 2022Verified Purchase
Baby Jersey Bodysuit, Black, 6 to 12 Month
Zazzle Reviewer Program
Very cute little suit, came extremely fast like a couple days! Great no issues with the printing
4.0 out of 5 stars rating
4 out of 5 stars rating
By Paige22 July 2023Verified Purchase
Baby Jersey Bodysuit, White, Newborn
Zazzle Reviewer Program
When I got the product it had a stain on it not happy as it is a gift for someone. Really good happy with it.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Pam B.21 August 2025Verified Purchase
Baby Jersey Bodysuit, White, Newborn
Very happy with it, it is a very cute onsie.

Tags

T-Shirts
artefactnecklaceamazoniteglitchglitchenwetdryvactinyspeckglitchthegame
All Products
artefactnecklaceamazoniteglitchglitchenwetdryvactinyspeckglitchthegame

Other Info

Product ID: 235783017963227885
Posted on 3/10/2014, 7:23 AM
Rating: G