Tap / click on image to see more RealViewsTM
$29.10
per mouse pad
 

Glitch: artefact platinumium spork mouse pad

Qty:

Other designs from this category

About Mousepads

Sold by

Style: Mouse Pad

Create a great accessory for the only mouse you want scurrying around with a custom mouse pad for your home or office! Decorate it with your favourite image or choose from thousands of designs that look great and protect your mouse from scratches and debris. You can also design fun mouse pads to hand out to new employees or to use as marketing materials!

  • Dimensions: 23.49 cm l x 19.68 cm w
  • High quality, full-colour printing
  • Durable and dust and stain resistant cloth cover
  • Non-slip rubber backing
  • Designer Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 23.49 cm x 19.68 cm

About This Design

Glitch: artefact platinumium spork mouse pad

Glitch: artefact platinumium spork mouse pad

Glitch: artefact platinumium spork This Glitch product is brought to you by the Vac of Wetdryvac.net, who is most thankful to the folks of GlitchTheGame.com and TinySpeck.com for releasing their entire body of artwork into the public domain. The Vac's plan is to convert and release as much of that artwork on Zazzle as it has the brain space for, to be shared with the Glitch community - a whole lot of seriously awesome folks who helped make the game as lovely as it was - any anyone else who fancies some excellent art printed on various products. Most of these products are converted from the original .fla files to .png with transparency at 4000x4000 pixels. If you’d like to go nab the source material yourself, you can do so here: http://www.glitchthegame.com/ Glitch, Glitchen, the vac misses you all!

Customer Reviews

4.8 out of 5 stars rating4.7K Total Reviews
4187 total 5-star reviews377 total 4-star reviews78 total 3-star reviews27 total 2-star reviews29 total 1-star reviews
4,698 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Angela B.6 December 2020Verified Purchase
Mousepad
Zazzle Reviewer Program
Delivery was so quick , under a week - I was amazed. The product was great quality and better than expected . I will be ordering more form Zazzle ! Printing was fantastic
5.0 out of 5 stars rating
5 out of 5 stars rating
By Tess M.30 January 2022Verified Purchase
Mousepad
Zazzle Reviewer Program
High quality and a bit of funk from your everyday plain mousepad. Excellent quality would highly recommend
5.0 out of 5 stars rating
5 out of 5 stars rating
By C.9 August 2020Verified Purchase
Mousepad
Zazzle Reviewer Program
Delighted with the mouse pad - thick enough to be confortable and much better quality than those in store. The printing was very crisp and the colours vivid

Tags

Mousepads
artefactplatinumiumsporkglitchglitchenwetdryvactinyspeckglitchthegame
All Products
artefactplatinumiumsporkglitchglitchenwetdryvactinyspeckglitchthegame

Other Info

Product ID: 144702747969380875
Posted on 3/10/2014, 7:30 AM
Rating: G