Tap / click on image to see more RealViewsTM
$83.20
per tie
 

Glitch: compounds tiite tie

Qty:

    Other designs from this category

    About Ties

    Sold by

    Style: Tie

    Upgrade your wardrobe with a custom tie from Zazzle! Design one-of-a-kind ties to match any suit, dress shirt, and occasion. Upload your own unique images and patterns, or browse thousands of stylish designs to wear in the office or on a night out in the town.

    • Dimensions:
      • Length: 139 cm
      • Width: 10.1 cm (at widest point)
    • Printed in vibrant full colour
    • Made from 100% polyester; silky finish
    • Double-sided printing available at small upcharge. Check out the "Design Area" tab to the right to customise
    • Dry clean only

    About This Design

    Glitch: compounds tiite tie

    Glitch: compounds tiite tie

    Glitch: compounds tiite This Glitch product is brought to you by the Vac of Wetdryvac.net, who is most thankful to the folks of GlitchTheGame.com and TinySpeck.com for releasing their entire body of artwork into the public domain. The Vac's plan is to convert and release as much of that artwork on Zazzle as it has the brain space for, to be shared with the Glitch community - a whole lot of seriously awesome folks who helped make the game as lovely as it was - any anyone else who fancies some excellent art printed on various products. Most of these products are converted from the original .fla files to .png with transparency at 4000x4000 pixels. If you’d like to go nab the source material yourself, you can do so here: http://www.glitchthegame.com/ Glitch, Glitchen, the vac misses you all!

    Customer Reviews

    4.5 out of 5 stars rating2.5K Total Reviews
    1819 total 5-star reviews325 total 4-star reviews144 total 3-star reviews74 total 2-star reviews119 total 1-star reviews
    2,481 Reviews
    Reviews for similar products
    5.0 out of 5 stars rating
    5 out of 5 stars rating
    By Libby L.14 July 2017 • Verified Purchase
    Tie
    Zazzle Reviewer Program
    Product was of good quality. The fabric is excellent
    5.0 out of 5 stars rating
    5 out of 5 stars rating
    By Janette C.28 February 2016 • Verified Purchase
    Tie
    Zazzle Reviewer Program
    Beautiful material, and finish. Smart tie for a special birthday, my Dads 80th. Will look smashing with a nice suit. Printing excellent nice and clear.
    5.0 out of 5 stars rating
    5 out of 5 stars rating
    By Libby L.14 July 2017 • Verified Purchase
    Tie
    Zazzle Reviewer Program
    Item is of very good quality. The fabric is excellent

    Tags

    compoundstiiteglitchglitchenwetdryvactinyspeckglitchthegame

    Other Info

    Product ID: 151113493191893803
    Posted on 3/10/2014, 8:43 AM
    Rating: G