Tap / click on image to see more RealViewsTM
$29.10
per notebook
 

Glitch Cthulhu Mask Spiral Notebook

Qty:

Other designs from this category

About Notebooks

Sold by

Style: 16.51 cm x 22.22 cm Classic Notebook

Organise your day with a custom notebook! Made with your images and text on the front cover, this notebook is a great way to show off your personal style and keep track of all important notes and appointments all at once.

  • Dimensions: 16.5 cm x 22.2 cm (6.5" x 8.75")
  • Cover printed in vibrant, sharp colour
  • 80 black & white lined pages
  • College ruled
  • Lay flat spiral binding
This product is recommended for ages 8+..
Creator Tip: To ensure the highest quality print, please note this product’s customisable design area measures 16.5 cm x 22.2 cm (6.5" x 8.75"). For best results please add 0.3 cm (1/8") bleed..

About This Design

Glitch Cthulhu Mask Spiral Notebook

Glitch Cthulhu Mask Spiral Notebook

Once upon a time, the Vac was a player on Glitch – possibly the very best game it’s ever invested in, bar none. Glitch closed its doors in 2012, and the vac bloody wept. Great game, great community, and the Vac misses you all like crazy. Community’s still going strong, incidentally – you guys rock. 2013, and TinySpeck.com – the good folks behind Glitch – released their entire archive, other than logo, to the public domain. You can learn about that over here: http://www.glitchthegame.com/public-domain-game-art/ That being the case, the Vac decided there needed to be Glitch stuff available to the world, so as it has time, it’s systematically working its way through the archives and making things available here for purchase. Everything here is public domain, and used with more gratitude than the Vac can possibly describe. Thank-you TinySpeck.com and Slack.com for doing this. Thank-you GlitchTheGame.com as well. Glitchen, here you go, and if you've requests for stuff you can't find, yell - I'll do my best to provide. Don't forget that on many products you can change image size, add text, change style, and change background colour by clicking customise. -Wetdryvac / Wetdryvac.net

Customer Reviews

4.8 out of 5 stars rating1.8K Total Reviews
1505 total 5-star reviews184 total 4-star reviews41 total 3-star reviews27 total 2-star reviews14 total 1-star reviews
1,771 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Kirsty R.1 January 2025Verified Purchase
16.51 cm x 22.22 cm Classic Notebook
Happy as with the book, the pages are plenty with happy with the thickness and lines of each page. Purchased another 2 books soon after purchasing the first 2!
5.0 out of 5 stars rating
5 out of 5 stars rating
By M.26 February 2024Verified Purchase
16.51 cm x 22.22 cm Classic Notebook
Zazzle Reviewer Program
Very good exactly what I was looking for. Just how I had asked for
5.0 out of 5 stars rating
5 out of 5 stars rating
By Susan H.20 April 2021Verified Purchase
16.51 cm x 22.22 cm Classic Notebook
Zazzle Reviewer Program
Excellent product and would purchase again. Excellent - as above

Tags

Notebooks
glitchglitchenmaskmaskswetdryvactinyspeckcthulhuglitchthegame
All Products
glitchglitchenmaskmaskswetdryvactinyspeckcthulhuglitchthegame

Other Info

Product ID: 130910448210295268
Posted on 23/11/2013, 5:27 PM
Rating: G