Tap / click on image to see more RealViewsTM
$51.70
per shirt
 

Glitch Cthulhu Mask T-Shirt

Qty:
  1. Size

  2. Style

  3. Colour & Print Process: Black

    Classic Printing: No Underbase
    Vivid Printing: White Underbase

Other designs from this category

About T-Shirts

Sold by

Style: Kids' Basic T-Shirt

Wait 'till you get this tee on your kiddo, it'll take his everyday style to a whole new level--especially when you customise it with your own design.

Size & Fit

  • Model is 135 cm and is wearing a medium
  • Garment is unisex sizing
  • Standard fit
  • True to size

Fabric & Care

  • 6.0 oz.,/203 gsm, pre-shrunk 100% ComfortSoft® cotton; Oxford Green is 60/40
  • Shoulder-to-shoulder taping with coverstitched collar
  • Double-needle stitched armholes and sleeves
  • Imported
  • Machine wash cold

About This Design

Glitch Cthulhu Mask T-Shirt

Glitch Cthulhu Mask T-Shirt

Once upon a time, the Vac was a player on Glitch – possibly the very best game it’s ever invested in, bar none. Glitch closed its doors in 2012, and the vac bloody wept. Great game, great community, and the Vac misses you all like crazy. Community’s still going strong, incidentally – you guys rock. 2013, and TinySpeck.com – the good folks behind Glitch – released their entire archive, other than logo, to the public domain. You can learn about that over here: http://www.glitchthegame.com/public-domain-game-art/ That being the case, the Vac decided there needed to be Glitch stuff available to the world, so as it has time, it’s systematically working its way through the archives and making things available here for purchase. Everything here is public domain, and used with more gratitude than the Vac can possibly describe. Thank-you TinySpeck.com and Slack.com for doing this. Thank-you GlitchTheGame.com as well. Glitchen, here you go, and if you've requests for stuff you can't find, yell - I'll do my best to provide. Don't forget that on many products you can change image size, add text, change style, and change background colour by clicking customise. -Wetdryvac / Wetdryvac.net

Customer Reviews

4.7 out of 5 stars rating1.9K Total Reviews
1472 total 5-star reviews279 total 4-star reviews78 total 3-star reviews29 total 2-star reviews29 total 1-star reviews
1,887 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Anonymous9 July 2026Verified Purchase
Kids Basic T-Shirt, Black, Youth XS
Lovely tee shirt thanks - Zazzle really is a great company. This is my second order and I’m so impressed. .
5.0 out of 5 stars rating
5 out of 5 stars rating
By B.31 March 2023Verified Purchase
Kids Basic T-Shirt, Black, Youth XS
Zazzle Reviewer Program
Perfect for a little boy dealing with school and becoming a big brother. He loves gaming with his dad so was awesome. Great. No flaws or anything different from what was advertised. Very happy little guy.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Smith T.17 June 2020Verified Purchase
Kids Basic T-Shirt, Black, Youth M
Zazzle Reviewer Program
The t-shirt feels and looks great quality, a good thick cotton. It will be a little big for my son, but that means he will be able to wear it and not out grow it too soon. The print was as described on the order when personalised. True size, shape and colour T-shirt- thanks.

Tags

T-Shirts
glitchglitchenmaskmaskswetdryvactinyspeckcthulhuglitchthegame
All Products
glitchglitchenmaskmaskswetdryvactinyspeckcthulhuglitchthegame

Other Info

Product ID: 235052121719704683
Posted on 23/11/2013, 5:27 PM
Rating: G