Tap / click on image to see more RealViewsTM
$83.20
per tie
 

Glitch Cthulhu Mask Tie

Qty:

Other designs from this category

About Ties

Sold by

Style: Tie

Upgrade your wardrobe with a custom tie from Zazzle! Design one-of-a-kind ties to match any suit, dress shirt, and occasion. Upload your own unique images and patterns, or browse thousands of stylish designs to wear in the office or on a night out in the town.

  • Dimensions:
    • Length: 139 cm
    • Width: 10.1 cm (at widest point)
  • Printed in vibrant full colour
  • Made from 100% polyester; silky finish
  • Double-sided printing available at small upcharge. Check out the "Design Area" tab to the right to customise
  • Dry clean only

About This Design

Glitch Cthulhu Mask Tie

Glitch Cthulhu Mask Tie

Once upon a time, the Vac was a player on Glitch – possibly the very best game it’s ever invested in, bar none. Glitch closed its doors in 2012, and the vac bloody wept. Great game, great community, and the Vac misses you all like crazy. Community’s still going strong, incidentally – you guys rock. 2013, and TinySpeck.com – the good folks behind Glitch – released their entire archive, other than logo, to the public domain. You can learn about that over here: http://www.glitchthegame.com/public-domain-game-art/ That being the case, the Vac decided there needed to be Glitch stuff available to the world, so as it has time, it’s systematically working its way through the archives and making things available here for purchase. Everything here is public domain, and used with more gratitude than the Vac can possibly describe. Thank-you TinySpeck.com and Slack.com for doing this. Thank-you GlitchTheGame.com as well. Glitchen, here you go, and if you've requests for stuff you can't find, yell - I'll do my best to provide. Don't forget that on many products you can change image size, add text, change style, and change background colour by clicking customise. -Wetdryvac / Wetdryvac.net

Customer Reviews

4.5 out of 5 stars rating2.5K Total Reviews
1806 total 5-star reviews325 total 4-star reviews142 total 3-star reviews72 total 2-star reviews116 total 1-star reviews
2,461 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Libby L.14 July 2017Verified Purchase
Tie
Zazzle Reviewer Program
Product was of good quality. The fabric is excellent
5.0 out of 5 stars rating
5 out of 5 stars rating
By Janette C.28 February 2016Verified Purchase
Tie
Zazzle Reviewer Program
Beautiful material, and finish. Smart tie for a special birthday, my Dads 80th. Will look smashing with a nice suit. Printing excellent nice and clear.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Libby L.14 July 2017Verified Purchase
Tie
Zazzle Reviewer Program
Item is of very good quality. The fabric is excellent

Tags

Ties
glitchglitchenmaskmaskswetdryvactinyspeckcthulhuglitchthegame
All Products
glitchglitchenmaskmaskswetdryvactinyspeckcthulhuglitchthegame

Other Info

Product ID: 151799404367149809
Posted on 23/11/2013, 5:27 PM
Rating: G