Tap / click on image to see more RealViewsTM
$3.75
per postcard
 

Glitch dustbunny cubimal postcard

Qty:
Signature Matte
18 pt thickness / 120 lb weight Soft white, soft eggshell texture
-$0.35

Other designs from this category

About Postcards

Sold by

Size: Standard Postcard

Create your own vacation-worthy postcard! Any view you’ve seen, any monument you’ve fallen in love with, can all be added to your postcard with our personalisation tool.

  • Dimensions: 14.22 cm L x 10.79 cm H; qualified USPS postcard size
  • High quality, full-colour, full-bleed printing on both sides

Paper Type: Signature Matte

Our Signature Matte paper is a customer favourite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle

About This Design

Glitch dustbunny cubimal postcard

Glitch dustbunny cubimal postcard

Once upon a time, the Vac was a player on Glitch – possibly the very best game it’s ever invested in, bar none. Glitch closed its doors in 2012, and the vac bloody wept. Great game, great community, and the Vac misses you all like crazy. Community’s still going strong, incidentally – you guys rock. 2013, and TinySpeck.com – the good folks behind Glitch – released their entire archive, other than logo, to the public domain. You can learn about that over here: http://www.glitchthegame.com/public-domain-game-art/ That being the case, the Vac decided there needed to be Glitch stuff available to the world, so as it has time, it’s systematically working its way through the archives and making things available here for purchase. Everything here is public domain, and used with more gratitude than the Vac can possibly describe. Thank-you TinySpeck.com and Slack.com for doing this. Thank-you GlitchTheGame.com as well. Glitchen, here you go, and if you've requests for stuff you can't find, yell - I'll do my best to provide. Don't forget that on many products you can change image size, add text, change style, and change background colour by clicking customise. -Wetdryvac / Wetdryvac.net

Customer Reviews

4.9 out of 5 stars rating15.7K Total Reviews
14305 total 5-star reviews1004 total 4-star reviews201 total 3-star reviews72 total 2-star reviews118 total 1-star reviews
15,700 Reviews
Reviews for similar products
5 out of 5 stars rating
By Heather D.20 September 2021Verified Purchase
Post Card, Size: Standard Postcard, Paper: Signature Matte, Envelopes: None
Zazzle Reviewer Program
It was exactly like the pic on Zazzle. Size was good to write on the back. Image was great. Lovely colours and clear
5 out of 5 stars rating
By Dash K.23 January 2024Verified Purchase
Post Card, Size: Standard Postcard, Paper: Signature Matte, Envelopes: None
Zazzle Reviewer Program
I was pleased with the excellent quality of the calendar and the high quality of the card stock used. I will definitely order these postcards again. The printing was excellent. I was so pleased!
5 out of 5 stars rating
By Lisa B.26 August 2019Verified Purchase
Post Card, Size: Standard Postcard, Paper: Signature Matte, Envelopes: None
Zazzle Reviewer Program
Such a huge range of different frogs available, which made my choices very difficult and now the reason I have a whole draw full of cards and postcards! Much better quality than you can buy in the shops and they are exactly on the subject I love and adore too.

Tags

Postcards
glitchglitchendustbunnydustbunnycubimalwetdryvactinyspeckglitchthegame
All Products
glitchglitchendustbunnydustbunnycubimalwetdryvactinyspeckglitchthegame

Other Info

Product ID: 239446639547759723
Posted on 23/11/2013, 5:38 PM
Rating: G