Tap / click on image to see more RealViewsTM
$58.45
per shirt
 

Glitch emo bear cubimal T-Shirt

Qty:
Womens Basic T-Shirt
+$18.35
+$45.60
+$20.00
Black
Classic Printing: No Underbase
-$11.55
-$11.55
-$11.55
-$11.55
-$11.55
Vivid Printing: White Underbase

Other designs from this category

About T-Shirts

Sold by

Style: Women's Basic T-Shirt

This basic t-shirt features a relaxed fit for the female shape. Made from 100% cotton, this t-shirt is both durable and soft – a great combination if you're looking for that casual wardrobe staple. Select a design from our marketplace or customise it and unleash your creativity!

Size & Fit

  • Model is 5'7"/170 cm and is wearing a Small
  • Standard fit
  • Fits true to size

Fabric & Care

  • 100% cotton
  • Tagless label for comfort
  • Double-needle hemmed sleeves and bottom
  • Machine wash cold
  • Imported

About This Design

Glitch emo bear cubimal T-Shirt

Glitch emo bear cubimal T-Shirt

Once upon a time, the Vac was a player on Glitch – possibly the very best game it’s ever invested in, bar none. Glitch closed its doors in 2012, and the vac bloody wept. Great game, great community, and the Vac misses you all like crazy. Community’s still going strong, incidentally – you guys rock. 2013, and TinySpeck.com – the good folks behind Glitch – released their entire archive, other than logo, to the public domain. You can learn about that over here: http://www.glitchthegame.com/public-domain-game-art/ That being the case, the Vac decided there needed to be Glitch stuff available to the world, so as it has time, it’s systematically working its way through the archives and making things available here for purchase. Everything here is public domain, and used with more gratitude than the Vac can possibly describe. Thank-you TinySpeck.com and Slack.com for doing this. Thank-you GlitchTheGame.com as well. Glitchen, here you go, and if you've requests for stuff you can't find, yell - I'll do my best to provide. Don't forget that on many products you can change image size, add text, change style, and change background colour by clicking customise. -Wetdryvac / Wetdryvac.net

Customer Reviews

4.6 out of 5 stars rating14.9K Total Reviews
10564 total 5-star reviews2867 total 4-star reviews829 total 3-star reviews384 total 2-star reviews253 total 1-star reviews
14,897 Reviews
Reviews for similar products
5 out of 5 stars rating
By H.31 March 2024Verified Purchase
My Clan Graham is high quality garment and its history even more important, Clan Graham fought for the right to wear kilts and won. Clan Graham, Duke of Montrose are advisors to China on renewable energy. Heavy duty Cotton. The design and colours are superb, I feel very proud as a Graham descendant from Appleby Westmorland Cumbria to wear this especially when wearing of patches is banned in Aotoearoa - New Zealand. Kiwis wear all black as the t shirt is with Green lettering to match the environment and yellow for joy and purple thistle to match my hair. The wardrobe police know who my Clan is now !
Original product
5 out of 5 stars rating
By M.11 June 2017Verified Purchase
Womens Basic T-Shirt, White, Adult L
Zazzle Reviewer Program
The tee shirt was of good quality and the photo true to original. The printing was just fine, as usual.
5 out of 5 stars rating
By Julia U.19 January 2024Verified Purchase
Womens Basic T-Shirt, White, Adult S
Zazzle Reviewer Program
It's a really great quality t. Shirt. The print was clear, and the colours great.

Tags

T-Shirts
glitchglitchenemobearcubimalwetdryvactinyspeckglitchthegame
All Products
glitchglitchenemobearcubimalwetdryvactinyspeckglitchthegame

Other Info

Product ID: 235217361453915941
Posted on 23/11/2013, 5:39 PM
Rating: G