Tap / click on image to see more RealViewsTM
$10.35
per magnet
 

Glitch gardening tools vendor cubimal magnet

Qty:
Circle
+$3.90
+$1.80
Small, 3.2 Cm
+$1.80
+$3.45

Other designs from this category

About Magnets

Sold by

Shape: Circle

Give your fridge a personality upgrade. Upload a photo, design, or logo and turn it into a magnet that actually looks good up there.

  • Available in 3 sizes: 3.2 cm, 5.7 cm, and 7.6 cm diameter
  • USA-made with recycled domestic steel
  • Smooth glossy mylar finish, scratch and UV-resistant
  • Printed on FSC-certified recycled paper
  • Standard fridge-strength magnet
  • Also available in square or rectangle

About This Design

Glitch gardening tools vendor cubimal magnet

Glitch gardening tools vendor cubimal magnet

Once upon a time, the Vac was a player on Glitch – possibly the very best game it’s ever invested in, bar none. Glitch closed its doors in 2012, and the vac bloody wept. Great game, great community, and the Vac misses you all like crazy. Community’s still going strong, incidentally – you guys rock. 2013, and TinySpeck.com – the good folks behind Glitch – released their entire archive, other than logo, to the public domain. You can learn about that over here: http://www.glitchthegame.com/public-domain-game-art/ That being the case, the Vac decided there needed to be Glitch stuff available to the world, so as it has time, it’s systematically working its way through the archives and making things available here for purchase. Everything here is public domain, and used with more gratitude than the Vac can possibly describe. Thank-you TinySpeck.com and Slack.com for doing this. Thank-you GlitchTheGame.com as well. Glitchen, here you go, and if you've requests for stuff you can't find, yell - I'll do my best to provide. Don't forget that on many products you can change image size, add text, change style, and change background colour by clicking customise. -Wetdryvac / Wetdryvac.net

Customer Reviews

4.8 out of 5 stars rating6.9K Total Reviews
6162 total 5-star reviews573 total 4-star reviews119 total 3-star reviews47 total 2-star reviews40 total 1-star reviews
6,941 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Michelle H.4 July 2023Verified Purchase
Magnet, Style: Circle, Size: Large, 7.6 Cm
Zazzle Reviewer Program
Great size, designed it all online and it was exactly as I designed it. Great sharp and clear image Arrived very quickly. I wished the photo was slightly brighter however this is how it was on the website when designing so it’s true to the design
5.0 out of 5 stars rating
5 out of 5 stars rating
By Dennis P.24 May 2023Verified Purchase
Magnet, Style: Circle, Size: Standard, 5.7 Cm
Zazzle Reviewer Program
I love it. The antique look awesome. A friend thought I'd had for years. 👍. Excellent writing and is very clear and sharp. 👍👌👍
5.0 out of 5 stars rating
5 out of 5 stars rating
By Paula H.10 July 2022Verified Purchase
Magnet, Style: Circle, Size: Large, 7.6 Cm
Zazzle Reviewer Program
High quality!!!!!!!!!! Brilliant design!!!!!!

Tags

Magnets
glitchglitchengardeningtoolsvendorcubimalwetdryvactinyspeckglitchthegame
All Products
glitchglitchengardeningtoolsvendorcubimalwetdryvactinyspeckglitchthegame

Other Info

Product ID: 147296928163539011
Posted on 23/11/2013, 5:41 PM
Rating: G