Tap / click on image to see more RealViewsTM
$9.05
per card
 

Glitch gnome cubimal

Qty:
Choose Your Format
Signature Matte
  • 17 pt thickness / 120 lb weight
  • Light white, uncoated matte finish with an eggshell texture
+$1.30
+$1.30
-$0.35

About Cards

Sold by

Size: Standard (12.7 cm x 17.8 cm)

Birthdays or holidays, good days or hard days, Zazzle’s customised greeting cards are the perfect way to convey your wishes on any occasion. Add a photo or pick a design and brighten someone’s day with a simple “hi”!

  • Dimensions: 12.7 cm x 17.8 cm (portrait) or 17.8 cm x 12.7 cm (landscape)
  • Full colour CMYK print process
  • All-sided printing for no additional cost
  • Printable area on the back of the card is 7.62 cm x 10.16 cm (portrait) or 10.16 cm x 7.62 cm (landscape)
  • Blank white envelopes included

Paper Type: Matte

The most popular paper choice, Matte’s eggshell texture is soft to the touch with a smooth finish that provides the perfect backdrop for your chosen designs.

  • Light white, uncoated matte finish with an eggshell texture
  • Paper is easy to write on and won't smudge

About This Design

Glitch gnome cubimal

Glitch gnome cubimal

Once upon a time, the Vac was a player on Glitch – possibly the very best game it’s ever invested in, bar none. Glitch closed its doors in 2012, and the vac bloody wept. Great game, great community, and the Vac misses you all like crazy. Community’s still going strong, incidentally – you guys rock. 2013, and TinySpeck.com – the good folks behind Glitch – released their entire archive, other than logo, to the public domain. You can learn about that over here: http://www.glitchthegame.com/public-domain-game-art/ That being the case, the Vac decided there needed to be Glitch stuff available to the world, so as it has time, it’s systematically working its way through the archives and making things available here for purchase. Everything here is public domain, and used with more gratitude than the Vac can possibly describe. Thank-you TinySpeck.com and Slack.com for doing this. Thank-you GlitchTheGame.com as well. Glitchen, here you go, and if you've requests for stuff you can't find, yell - I'll do my best to provide. Don't forget that on many products you can change image size, add text, change style, and change background colour by clicking customise. -Wetdryvac / Wetdryvac.net

Customer Reviews

4.9 out of 5 stars rating7.4K Total Reviews
6734 total 5-star reviews487 total 4-star reviews70 total 3-star reviews27 total 2-star reviews34 total 1-star reviews
7,352 Reviews
Reviews for similar products
5 out of 5 stars rating
By Lisa B.26 August 2019Verified Purchase
Folded Card, Size: Standard (12.7 cm x 17.8 cm), Paper: Signature Matte
Zazzle Reviewer Program
Such a huge range of different frogs available, which made my choices very difficult and now the reason I have a whole draw full of cards and postcards! Top quality product - better than you buy in the shops!
5 out of 5 stars rating
By Anonymous26 November 2024Verified Purchase
Folded Card, Size: Standard (12.7 cm x 17.8 cm), Paper: Signature Matte
Fantastic to be able to customise your cards. Always been really happy with what I have ordered. Michelle.
5 out of 5 stars rating
By Lisa B.26 August 2019Verified Purchase
Folded Card, Size: Standard (12.7 cm x 17.8 cm), Paper: Signature Matte
Zazzle Reviewer Program
Such a huge range of different frogs available, which made my choices very difficult and now the reason I have a whole draw full of cards and postcards! Top quality product indeed!

Tags

Cards
glitchglitchengardengnomecubimalwetdryvactinyspeckglitchthegame
All Products
glitchglitchengardengnomecubimalwetdryvactinyspeckglitchthegame

Other Info

Product ID: 137647836133156796
Posted on 23/11/2013, 5:41 PM
Rating: G