Tap / click on image to see more RealViewsTM
$53.00
per apron
 

Glitch Lem Mask Standard Apron

Qty:
Standard
White

Other designs from this category

About Aprons

Sold by

Size: Standard

You won’t have to kiss the cook if you get them one of these classic aprons. It's super useful with its three spacious front pockets - perfect for all your utensils and tools. Select a design from our marketplace or customise it and unleash your creativity!

  • Dimensions: 60.96 cm L x 71.12 cm W
  • Material: 100% Polyester
  • Machine washable

About This Design

Glitch Lem Mask Standard Apron

Glitch Lem Mask Standard Apron

Once upon a time, the Vac was a player on Glitch – possibly the very best game it’s ever invested in, bar none. Glitch closed its doors in 2012, and the vac bloody wept. Great game, great community, and the Vac misses you all like crazy. Community’s still going strong, incidentally – you guys rock. 2013, and TinySpeck.com – the good folks behind Glitch – released their entire archive, other than logo, to the public domain. You can learn about that over here: http://www.glitchthegame.com/public-domain-game-art/ That being the case, the Vac decided there needed to be Glitch stuff available to the world, so as it has time, it’s systematically working its way through the archives and making things available here for purchase. Everything here is public domain, and used with more gratitude than the Vac can possibly describe. Thank-you TinySpeck.com and Slack.com for doing this. Thank-you GlitchTheGame.com as well. Glitchen, here you go, and if you've requests for stuff you can't find, yell - I'll do my best to provide. Don't forget that on many products you can change image size, add text, change style, and change background colour by clicking customise. -Wetdryvac / Wetdryvac.net

Customer Reviews

4.8 out of 5 stars rating2.3K Total Reviews
1937 total 5-star reviews303 total 4-star reviews39 total 3-star reviews15 total 2-star reviews13 total 1-star reviews
2,307 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Lynn S.23 March 2022Verified Purchase
Apron, Standard
Zazzle Reviewer Program
I was so excited with the aprons and they look amazing. Can't wait to use these at Christmas with my Grandchildren in the play food truck we are making them. Loved the printing it turned out really well
5.0 out of 5 stars rating
5 out of 5 stars rating
By Lorraine S.4 January 2022Verified Purchase
Zazzle Reviewer Program
Excellent quality, fabric good weight and well constructed, fit for purpose, printing was good and clear. product was bought already printed, excellent quality
Original product
5.0 out of 5 stars rating
5 out of 5 stars rating
By Patricia P.2 September 2020Verified Purchase
Apron, Standard
Zazzle Reviewer Program
My daughter in law loved this gift. She loved the shorter length and the pockets. Good durable fabric and well made. Would highly recommend. The printing was awesome.. the only comment I would make is that the print could be placed higher on the bib part as when it is tied around the waist you can’t see the writing well.

Tags

Aprons
glitchglitchengiantgiantsmaskmaskslemwetdryvactinyspeckglitchthegame
All Products
glitchglitchengiantgiantsmaskmaskslemwetdryvactinyspeckglitchthegame

Other Info

Product ID: 154897660550990101
Posted on 23/11/2013, 5:29 PM
Rating: G