Tap / click on image to see more RealViewsTM
$94.05
per clock
 

Glitch: limited edition imitation grichmas yeti round clock

Qty:
20.3 cm Acrylic
+$12.95
+$12.95
-$11.90
-$11.90
-$11.90

Other designs from this category

About Wall Clocks

Sold by

Style: 20.3 cm Round Acrylic Wall Clock

Customise your wall clock to create a functional wall décor statement piece to perfectly match your home décor, show off your art or favourite photo, or give as a personalised gift. This unique, high-quality wall clock is vibrantly printed with AcryliPrint®HD process and features a pre-installed backside hanging slot for easy hanging and a non-ticking design.

  • 2 sizes: 20.32 cm diameter or 27.30 cm diameter
  • Material: Grade-A acrylic
  • One AA battery required (not included)
  • Add photos, artwork, and text
  • Indoor use only, not recommended for outdoor use

About This Design

Glitch: limited edition imitation grichmas yeti round clock

Glitch: limited edition imitation grichmas yeti round clock

Glitch: limited edition imitation grichmas yeti This Glitch product is brought to you by the Vac of Wetdryvac.net, who is most thankful to the folks of GlitchTheGame.com and TinySpeck.com for releasing their entire body of artwork into the public domain. The Vac's plan is to convert and release as much of that artwork on Zazzle as it has the brain space for, to be shared with the Glitch community - a whole lot of seriously awesome folks who helped make the game as lovely as it was - any anyone else who fancies some excellent art printed on various products. Most of these products are converted from the original .fla files to .png with transparency at 4000x4000 pixels. If you’d like to go nab the source material yourself, you can do so here: http://www.glitchthegame.com/ Glitch, Glitchen, the vac misses you all!

Customer Reviews

4.7 out of 5 stars rating3.5K Total Reviews
2878 total 5-star reviews389 total 4-star reviews77 total 3-star reviews45 total 2-star reviews68 total 1-star reviews
3,457 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Julie-Anne M.18 June 2022Verified Purchase
Wall Clock, 27.3 cm Acrylic
Zazzle Reviewer Program
I was thrilled when it arrived. It is extremely good quality. The colours were vivid and pretty
5.0 out of 5 stars rating
5 out of 5 stars rating
By L.7 March 2022Verified Purchase
Wall Clock, 27.3 cm Acrylic
Zazzle Reviewer Program
it was amazing i liked it
5.0 out of 5 stars rating
5 out of 5 stars rating
By Michelle E.19 January 2022Verified Purchase
Wall Clock, 25.4 cm Black Wooden Frame
Zazzle Reviewer Program
The clock did not take as long to arrive as I thought it might and was extremely well packaged. I didn't do the measurements so I didn't realize it is a little smaller than the average clock but that does not matter (just make sure you check if that's important to you).It is really nifty! It seems very solid and well made not flimsy at all. It has been going well and has kept good time in its few weeks on my wall. Nice product. Gets noticed too! Nicer in real life than the picture but true to the picture

Tags

Wall Clocks
limitededitionimitationgrichmasyetiglitchglitchenwetdryvactinyspeckglitchthegame
All Products
limitededitionimitationgrichmasyetiglitchglitchenwetdryvactinyspeckglitchthegame

Other Info

Product ID: 256753996524584946
Posted on 3/10/2014, 7:10 AM
Rating: G