Tap / click on image to see more RealViewsTM
$8.75
per sticker
 

Goat Stickers

Qty:

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by

Sticker Sheet Size: 7.62 cm x 7.62 cm

Design your own custom contour kiss-cut vinyl stickers. Upload one design for a single standout sticker, or add up to 30 different designs per sheet. Each sticker is individually kiss-cut with precision laser technology to match the exact shape of your artwork, giving you that clean die-cut look on an easy-peel vinyl sheet.

  • Sheet Size: 7.6 cm L x 3.12.7 cm W
  • Design Area: 7.6 cm L x 7.6 cm W
  • Up to 30 contour-cut stickers per sheet
  • Each sticker is cut to the exact shape of your image
  • Removable, low-tack adhesive that peels clean with no residue
  • Available in matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks: fade-proof, waterproof, and scratch-resistant
  • Available in 6 sizes
  • A 0.1212.7 cm border is added around each sticker to protect your design and help it pop on any surface
⚠️ WARNING! Choking hazard. Small parts. Not for children under 3 years.

About This Design

Goat Stickers

Goat Stickers

Great Design for Journals, Notebooks, School Projects etc..

Customer Reviews

4.5 out of 5 stars rating1.1K Total Reviews
922 total 5-star reviews70 total 4-star reviews27 total 3-star reviews30 total 2-star reviews92 total 1-star reviews
1,141 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By D.16 August 2023Verified Purchase
20.32 cm x 20.32 cm Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
The material is allotcthicker and works well...colors allot more solid than before, improved printing...no ink jet print affects. Just adhesion level abit low the use on certain plastics. The colors were allot more solid than the last ones and didn't look like "ink jet printer" quality...more improved this time round... The stick adhesion was abit low than I expected and so doesn't stick on to every kind of plastic...thus using 3M stick to aid adhesion. Just need to improve the adhesion levels.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Georgia B.4 May 2022Verified Purchase
20.32 cm x 20.32 cm Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
they are so bright and awesome, I love these and I'm so happy how they turned out. I think great. I think the printing is amazing.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Debra S.10 July 2024Verified Purchase
7.62 cm x 7.62 cm Custom-Cut Vinyl Stickers, Matte White
A+ Love these stickers! All my friends know if this sticker is on something it belongs to me. They are great quality. They don’t peel and are water resistant. I give them away as gifts and they are grilled to receive. Printing is first class! Colors are beautiful and don’t fade or peel. The design is nice on the eyes and decorate all kinds of things.
from zazzle.com (US)

Tags

Custom-Cut Vinyl Stickers
goatmilkcheesedairyanimalpetlivestockfarmhornspets
All Products
goatmilkcheesedairyanimalpetlivestockfarmhornspets

Other Info

Product ID: 256875953090371930
Posted on 1/05/2023, 5:58 AM
Rating: G