Tap / click on image to see more RealViewsTM
$11.10
per magnet
 

God Speed Edmund Leighton Fine Art Mediaeval Magnet

Qty:
  1. Shape

  2. Size

Other designs from this category

About Magnets

Sold by

Shape: Rectangle

Give your fridge a personality upgrade. Upload a photo, design, or logo and turn it into a magnet that actually looks good up there.

  • Dimensions: 8.9 cm L x 6.35 cm W (landscape) or 6.35 cm L x 8.9 cm W (portrait)
  • USA-made with recycled domestic steel
  • Smooth glossy mylar finish, scratch and UV-resistant
  • Printed on FSC-certified recycled paper
  • Standard fridge-strength magnet

About This Design

God Speed Edmund Leighton Fine Art Mediaeval Magnet

God Speed Edmund Leighton Fine Art Mediaeval Magnet

Edmund Leighton - God Speed. Oil on Canvas. Year: 1900, Public domain.

Customer Reviews

4.8 out of 5 stars rating7K Total Reviews
6182 total 5-star reviews575 total 4-star reviews119 total 3-star reviews47 total 2-star reviews44 total 1-star reviews
6,967 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Dominique22 May 2026Verified Purchase
Magnet, Style: Circle, Size: 5.72 cm
I loved all my items,and got so many compliments,and inquiries on where to buy,and directed everyone to zazzle.
from zazzle.com (US)
5.0 out of 5 stars rating
5 out of 5 stars rating
By Delores C.13 August 2025Verified Purchase
Magnet, Style: Rectangle, Size: 8.9 cm x 6.4 cm
Creator Review
The magnet is sturdy and bright and the print quality is great! .
from zazzle.com (US)
5.0 out of 5 stars rating
5 out of 5 stars rating
By julie g.1 September 2025Verified Purchase
Magnet, Style: Rectangle, Size: 8.9 cm x 6.4 cm
Nice clear image on magnet just as advertised.
from zazzle.com (US)

Tags

Magnets
leightonwarknightmaidenmediaevalfantasyfine artlovecastlehorse
All Products
leightonwarknightmaidenmediaevalfantasyfine artlovecastlehorse

Other Info

Product ID: 256868322552475579
Posted on 1/08/2023, 7:12 AM
Rating: G