Tap / click on image to see more RealViewsTM
$51.55
per planner
 

God Speed Edmund Leighton Fine Art Mediaeval Planner

Qty:
Black

Other designs from this category

About Planners

Sold by

Size: Standard (21.6 cm x 27.9 cm)

It's time to get organised! Plan your days in style with the help of a customisable planner. Perfect for your busy lifestyle, this planner has a place to plan your months, plan your weeks, and write down everything that's important to you!

  • Dimensions: 21.59 cm x 27.94 cm
  • One sheet of fun and colourful repositionable stickers in back (shown)
  • Includes monthly and weekly layouts, 12 months, 60 pages
  • Softcover front and back covers laminated
  • Wire-o® spiral spine available in three colour options
Fully committed to providing high quality and safe products, this product is Consumer Product Safety Improvement Act (CPSIA) compliant. Tracking label available on inside back cover.

About This Design

God Speed Edmund Leighton Fine Art Mediaeval Planner

God Speed Edmund Leighton Fine Art Mediaeval Planner

Edmund Leighton - God Speed. Oil on Canvas. Year: 1900, Public domain.

Customer Reviews

4.7 out of 5 stars rating291 Total Reviews
250 total 5-star reviews24 total 4-star reviews3 total 3-star reviews3 total 2-star reviews11 total 1-star reviews
291 Reviews
Reviews for similar products
5 out of 5 stars rating
By J.9 January 2024Verified Purchase
Standard (21.6 cm x 27.9 cm), Soft Cover, Gold Spiral Planner
Zazzle Reviewer Program
I can’t thank you enough for this item! The photos are crystal clear and the finish is beautiful. Very impressed with the finished product. I will be buying again. Crystal clear photos and the cover is gorgeous.
5 out of 5 stars rating
By Andreja K.24 July 2021Verified Purchase
Small (14 cm x 21.6 cm), Soft Cover, White Spiral Planner
Zazzle Reviewer Program
The hardcovers are super sturdy, they came undamaged, the print on the front was as expected. The interior of the notebook is good for planning monthly and weekly. The notes section is a bit small for my taste, but I can manage. I like the idea that months are only numbered at the beginning and not afterward, you get to write the numbers of the days and weeks as you wish. The printing turned out as expected, not too big of a difference from the colors seen on screen.
from zazzle.com (US)
5 out of 5 stars rating
By Teresa P.19 August 2025Verified Purchase
Standard (21.6 cm x 27.9 cm), Hard Cover, Black Spiral Planner
Creator Review
I Love my Zazzle Planner. Love the hard cover which makes writing in the planner so much easier., The daily planner pages are perfect for keeping track of daily events. The image colors and design are vibrant and awesome. Thank You for such a GREAT Planner.
from zazzle.com (US)

Tags

Planners
leightonwarknightmaidenmediaevalfantasyfine artlovecastlehorse
All Products
leightonwarknightmaidenmediaevalfantasyfine artlovecastlehorse

Other Info

Product ID: 256869878912485903
Posted on 13/01/2024, 12:00 AM
Rating: G