Tap / click on image to see more RealViewsTM
$12.30
per set of 6 labels
 

Green Watercolor Wedding Table Number Wine Label

Qty:
Wine Bottle Label 8.9 cm x 10.2 cm (3.5"x 4")
-$2.05
-$4.10
+$8.30
+$8.30
+$8.30
+$8.30
+$8.30

Other designs from this category

About Food and Beverage Label Sets

Sold by

Style: Wine Bottle Label 8.9 cm x 10.2 cm (3.5"x 4")

Easily customise a bottle of wine and make it 100% your own by adding a label! Perfect for weddings, bachelor parties and birthday parties.

  • Dimensions: 8.9 cm x 10.1 cm; fits most standard sized wine bottles
  • Each set includes 6 matte labels
  • Scratch-resistant and waterproof
  • Vibrant, full-colour, photo-quality printing that stands the test of time
  • Easy peel-and-stick method; labels are easily applied by removing the crack and peel backing to expose the permanent adhesive
Creator Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 8.9 cm x 10.1 cm. For best results please add a 3 mm bleed.

About This Design

Green Watercolor Wedding Table Number Wine Label

Green Watercolor Wedding Table Number Wine Label

Make a statement at your wedding or event tables with our beautiful green watercolor table number wine labels. The design features a delicate watercolor motif in shades of green, adding a natural and elegant touch to your table setting. The labels are fully customisable. These table number labels are perfect to put on wine bottles, or any other beverage, as a way to indicate table numbers. These table number labels are printed on high-quality, waterproof and adhesive material, making it easy to stick and display on your bottles. Impress your guests with our stunning green watercolor table number wine labels at your special event.

Customer Reviews

4.8 out of 5 stars rating597 Total Reviews
550 total 5-star reviews28 total 4-star reviews4 total 3-star reviews5 total 2-star reviews10 total 1-star reviews
597 Reviews
Reviews for similar products
5 out of 5 stars rating
By T.18 October 2020Verified Purchase
Wine Bottle Label 8.9 cm x 10.2 cm (3.5"x 4")
Zazzle Reviewer Program
Labels arrived quickly and look great. Was so simple to put together and get ordered. Great for any occasion with being able to customise the labels. Definitely recommend. Printing was perfect. Clear as
5 out of 5 stars rating
By Erika C.3 November 2021Verified Purchase
Wine Bottle Label 8.9 cm x 10.2 cm (3.5"x 4")
Zazzle Reviewer Program
So many to choose from, everything was perfect, ease of website, shipping and quality of product. Great Quality and perfect sizing.
5 out of 5 stars rating
By Kasey M.31 August 2021Verified Purchase
Zazzle Reviewer Program
amazing product worked perfectly exactly what i wanted. great printing good quality
Original product

Tags

Food and Beverage Label Sets
greenelegantbohocalligraphyweddingfancydarkclassicfairytale
All Products
greenelegantbohocalligraphyweddingfancydarkclassicfairytale

Other Info

Product ID: 256730755502215084
Posted on 27/01/2023, 7:57 AM
Rating: G