Tap / click on image to see more RealViewsTM
$4.65
per button
 

Green Woman - Wood 3 Cm Round Badge

Qty:
Round Badge
+$2.85
+$1.55
Small, 3.2 cm (1.25")

Other designs from this category

About badges

Sold by

Shape: Round Badge

With Zazzle badges buttons, you can do more than just express a political opinion. Since you can add your own designs, pictures, and text, you can express just about anything you can think of. Start creating amazing flair today!

  • Available in 5 sizes from 3.18 cm to 15.24 cm diameter
  • Covered with scratch and UV-resistant Mylar
  • Square buttons available too
  • Made in the U.S.A.
  • This product contains a functional sharp point. Not for children under 3 years of age

About This Design

Green Woman - Wood 3 Cm Round Badge

Green Woman - Wood 3 Cm Round Badge

A Green Woman carved in wood with paint applied to the oak leaves and hair. Also known as a foliate head, the Green Man/Wild Man, is a motif in architecture and art, a face composed of, or completely surrounded by, foliage, most often spreading out from the centre of the face. Apart from a purely decorative function, the Green Man is interpreted as a symbol of rebirth, representing the cycle of new growth that occurs every spring. Found in many cultures from many ages around the world, the Green Man is often related to natural vegetation deities. The female equivalent of the Green Man is often referred to as the Green Woman or the Sheela-Na-Gig. These figures. often depicted with a leafy crown or luxuriant hair, symbolising her connection to the natural world, are associated with fertility, nature, and the wild. In some contexts, the "Wild Woman" or the "Glaistig" (a type of sea spirit in Scottish folklore) can also be considered female equivalents of the Green Man, representing different aspects of nature's wildness and power.

Customer Reviews

4.8 out of 5 stars rating8.5K Total Reviews
7594 total 5-star reviews629 total 4-star reviews131 total 3-star reviews58 total 2-star reviews67 total 1-star reviews
8,479 Reviews
Reviews for similar products
5 out of 5 stars rating
By p.2 March 2023Verified Purchase
Round Badge, Standard, 5.7 cm (2.25")
Zazzle Reviewer Program
Cute designs, clear, bright and well priced as well. Utterly love it and so does Low Vision brother. A million times better than the boring and expensive Blind Foundation ones. Will buy again for sure. Perfect, good design, clear and colourful.
5 out of 5 stars rating
By Gunjan M.11 December 2022Verified Purchase
Round Badge, Standard, 5.7 cm (2.25")
Zazzle Reviewer Program
Beautiful badge for the new daddy to be. Good size options to suit your needs. Clear print and colourful badge.
5 out of 5 stars rating
By K.19 November 2021Verified Purchase
Round Badge, Standard, 5.7 cm (2.25")
Zazzle Reviewer Program
Great well made badge. Gives my customers peace of mind. And so attractive too - great design! So popular with my customers I have had several requests to supply them. Perfect. Very high quality.

Tags

badges
nature religiongoddessgreen womangreen manwild manfertilitymediaevalpaganwicca
All Products
nature religiongoddessgreen womangreen manwild manfertilitymediaevalpaganwicca

Other Info

Product ID: 256305253868111648
Posted on 23/04/2025, 9:56 AM
Rating: G