Tap / click on image to see more RealViewsTM
$7.25
per bottle opener
 

Green Woman - Wood Bottle Opener

Qty:

Other designs from this category

About Bottle Opener

Sold by

Style: Bottle Opener

Make all your bottle openers fancy with Zazzle! Customise this magnet-backed bottle opener with your favorite images, designs, or text! Made to “stick" to any metal surface, this bottle opener looks great on your refrigerator, is perfect for parties, and makes an even better gift!

  • Dimensions: 5.7 cm diameter
  • Print area covered with scratch and UV-resistant Mylar
  • Opens standard beer and soda cap bottles
  • Made in U.S.A.

⚠️WARNING! Choking hazard — Small parts; Not for children under 3 years.

⚠️ CAUTION! This product contains a strong magnet. Neodymium magnets are not a toy. Children should not be allowed to handle neodymium magnets as they can be dangerous. Small magnets pose a choking hazard and should never be swallowed or inserted into any part of the body. Swallowed magnets can stick together across intestines causing serious infections and death. Seek immediate medical attention if magnets are swallowed or inhaled.

Never allow neodymium magnets near a person with a pacemaker or similar medical aid. The strong magnetic fields of the magnet can affect the operation of such devices, which may result in injury or even death.

The strong magnetic fields of neodymium magnets can also damage magnetic data storage media and electronic devices. Keep these magnets away from credit cards, computer disks, video tapes, and other magnetic media. Never place these magnets near televisions, VCRs, computer monitors, or other electronic equipment.

About This Design

Green Woman - Wood Bottle Opener

Green Woman - Wood Bottle Opener

A Green Woman carved in wood with paint applied to the oak leaves and hair. Also known as a foliate head, the Green Man/Wild Man, is a motif in architecture and art, a face composed of, or completely surrounded by, foliage, most often spreading out from the centre of the face. Apart from a purely decorative function, the Green Man is interpreted as a symbol of rebirth, representing the cycle of new growth that occurs every spring. Found in many cultures from many ages around the world, the Green Man is often related to natural vegetation deities. The female equivalent of the Green Man is often referred to as the Green Woman or the Sheela-Na-Gig. These figures. often depicted with a leafy crown or luxuriant hair, symbolising her connection to the natural world, are associated with fertility, nature, and the wild. In some contexts, the "Wild Woman" or the "Glaistig" (a type of sea spirit in Scottish folklore) can also be considered female equivalents of the Green Man, representing different aspects of nature's wildness and power.

Customer Reviews

4.8 out of 5 stars rating162 Total Reviews
138 total 5-star reviews19 total 4-star reviews3 total 3-star reviews1 total 2-star reviews1 total 1-star reviews
162 Reviews
Reviews for similar products
4 out of 5 stars rating
By Steve S.18 February 2020Verified Purchase
Bottle Opener
Zazzle Reviewer Program
Very good for the cost would recomend to others. Not bad for the price i wssnt expecting much but they definitly turned out good
5 out of 5 stars rating
By Karen B.1 February 2024Verified Purchase
Bottle Opener
Zazzle Reviewer Program
Loved the quality of the opener. Very vibrant colors & especially liked the strong magnets. Absolutely recommend this. Very vibrant. Love it! Great gift
from zazzle.com (US)
5 out of 5 stars rating
By Anonymous17 September 2025Verified Purchase
Bottle Opener
I put them in the gift bags and everyone loved them at the baby shower!!! They were adorable! ♥️.
from zazzle.com (US)

Tags

Bottle Opener
nature religiongoddessgreen womangreen manwild manfertilitymediaevalpaganwicca
All Products
nature religiongoddessgreen womangreen manwild manfertilitymediaevalpaganwicca

Other Info

Product ID: 256250449226593531
Posted on 23/04/2025, 10:30 AM
Rating: G