Tap / click on image to see more RealViewsTM
$20.60
per coaster
 

Green Woman - Wood Coaster

Qty:

    Other designs from this category

    About Coasters

    Sold by

    Style: Sandstone Drink Coaster

    Mom always told you to use a coaster, so make her happy by using one from Zazzle! Made to keep your tables scratch-and-moisture-free, our sandstone coasters have a cork backing, so you can use them on any surface. They also have a matte finish and work best with vintage illustrations, black-and-white photos, and personal text messages.

    • Dimensions:
      • Diameter: 10.8 cm
      • Thickness: 0.6 cm
      • Weight: 110 g.
    • Made of sandstone with a cork pad backing
    • Not dishwasher safe
    Creator Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 10.8 cm x 10.8 cm. For best results please add 0.3 cm (1/8") bleed.

    About This Design

    Green Woman - Wood Coaster

    Green Woman - Wood Coaster

    A Green Woman carved in wood with paint applied to the oak leaves and hair. Also known as a foliate head, the Green Man/Wild Man, is a motif in architecture and art, a face composed of, or completely surrounded by, foliage, most often spreading out from the centre of the face. Apart from a purely decorative function, the Green Man is interpreted as a symbol of rebirth, representing the cycle of new growth that occurs every spring. Found in many cultures from many ages around the world, the Green Man is often related to natural vegetation deities. The female equivalent of the Green Man is often referred to as the Green Woman or the Sheela-Na-Gig. These figures. often depicted with a leafy crown or luxuriant hair, symbolising her connection to the natural world, are associated with fertility, nature, and the wild. In some contexts, the "Wild Woman" or the "Glaistig" (a type of sea spirit in Scottish folklore) can also be considered female equivalents of the Green Man, representing different aspects of nature's wildness and power.

    Customer Reviews

    4.6 out of 5 stars rating504 Total Reviews
    394 total 5-star reviews70 total 4-star reviews20 total 3-star reviews7 total 2-star reviews13 total 1-star reviews
    504 Reviews
    Reviews for similar products
    5.0 out of 5 stars rating
    5 out of 5 stars rating
    By Martijn8 July 2019Verified Purchase
    Sandstone Coaster
    Zazzle Reviewer Program
    Coaster looks really nice. I just got it so not sure about quality and durability yet... Colours and image quality look great.
    5.0 out of 5 stars rating
    5 out of 5 stars rating
    By Martijn8 July 2019Verified Purchase
    Sandstone Coaster
    Zazzle Reviewer Program
    Coaster looks really nice. I just got it so not sure about quality and durability yet... Colours and image quality look great.
    5.0 out of 5 stars rating
    5 out of 5 stars rating
    By Bob3 November 2012Verified Purchase
    Sandstone Coaster
    Zazzle Reviewer Program
    surprisingly good quality......not just a casual gift. sharp and appropriate
    from zazzle.com (US)

    Tags

    Coasters
    nature religiongoddessgreen womangreen manwild manfertilitymediaevalpaganwicca
    All Products
    nature religiongoddessgreen womangreen manwild manfertilitymediaevalpaganwicca

    Other Info

    Product ID: 256817263225016912
    Posted on 23/04/2025, 10:57 AM
    Rating: G