Tap / click on image to see more RealViewsTM
$82.65
per clock
 

Green Woman - Wood Large Clock

Qty:
27.3 cm Round Acrylic
-$9.50
-$18.75
-$18.75
-$18.75

Other designs from this category

About Wall Clocks

Sold by

Style: 27.3 cm Round Acrylic Wall Clock

Customise your wall clock to create a functional wall décor statement piece to perfectly match your home décor, show off your art or favourite photo, or give as a personalised gift. This unique, high-quality wall clock is vibrantly printed with AcryliPrint®HD process and features a pre-installed backside hanging slot for easy hanging and a non-ticking design.

  • 2 sizes: 20.32 cm diameter or 27.3 cm diameter
  • Material: Grade-A acrylic
  • One AA battery required (not included)
  • Add photos, artwork, and text
  • Indoor use only, not recommended for outdoor use
California Residents: Prop 65 Disclaimer
WarningWARNING: This product can expose you to chemicals including lead, which is known to the State of California to cause cancer and birth defects or other reproductive harm. For more information, go to www.P65Warnings.ca.gov.

About This Design

Green Woman - Wood Large Clock

Green Woman - Wood Large Clock

A Green Woman carved in wood with paint applied to the oak leaves and hair. Also known as a foliate head, the Green Man/Wild Man, is a motif in architecture and art, a face composed of, or completely surrounded by, foliage, most often spreading out from the centre of the face. Apart from a purely decorative function, the Green Man is interpreted as a symbol of rebirth, representing the cycle of new growth that occurs every spring. Found in many cultures from many ages around the world, the Green Man is often related to natural vegetation deities. The female equivalent of the Green Man is often referred to as the Green Woman or the Sheela-Na-Gig. These figures. often depicted with a leafy crown or luxuriant hair, symbolising her connection to the natural world, are associated with fertility, nature, and the wild. In some contexts, the "Wild Woman" or the "Glaistig" (a type of sea spirit in Scottish folklore) can also be considered female equivalents of the Green Man, representing different aspects of nature's wildness and power.

Customer Reviews

4.7 out of 5 stars rating3.4K Total Reviews
2839 total 5-star reviews385 total 4-star reviews77 total 3-star reviews42 total 2-star reviews61 total 1-star reviews
3,404 Reviews
Reviews for similar products
5 out of 5 stars rating
By Rachel H.14 September 2020Verified Purchase
Wall Clock, 27.3 cm Round Acrylic
Zazzle Reviewer Program
Thank you so much for this beautiful wall-clock. It was exactly designed the way I wanted and the finishing touches are amazing too. Beyond satisfied with the printing, colour and design.
5 out of 5 stars rating
By Shirley K.2 May 2022Verified Purchase
Wall Clock, 27.3 cm Round Acrylic
Zazzle Reviewer Program
It's absolutely beautiful, exactly what was shown Thankyou. So happy with the printing and the colors, can't wait to give to my husband for our 20th wedding anniversary.
5 out of 5 stars rating
By karen B.9 October 2021Verified Purchase
Wall Clock, 25.4 cm Round Black Wooden Frame
Zazzle Reviewer Program
Works well.look lovely great delivery time unique art love ut karen brown. Great item beautiful to look at and works well

Tags

Wall Clocks
nature religiongoddessgreen womangreen manwild manfertilitymediaevalpaganwicca
All Products
nature religiongoddessgreen womangreen manwild manfertilitymediaevalpaganwicca

Other Info

Product ID: 256686808927638609
Posted on 23/04/2025, 10:32 AM
Rating: G