Tap / click on image to see more RealViewsTM
$6.20
per magnet
 

Green Woman - Wood Magnet

Qty:
Circle
+$2.35
+$1.05
Small, 3.2 Cm

Other designs from this category

About Magnets

Sold by

Shape: Circle

Your refrigerator called and said it was feeling mighty lonely. Why not give it a few friends to play with by creating a couple of custom magnets! Add your favourite image to a round magnet, or shop the thousands of options for a cool square magnet.

  • Available in 3 sizes from 3.1 cm to 7.6 cm diameter
  • Printed on 100% recycled paper
  • Covered with scratch and UV-resistant mylar
  • Available in square shape also

About This Design

Green Woman - Wood Magnet

Green Woman - Wood Magnet

A Green Woman carved in wood with paint applied to the oak leaves and hair. Also known as a foliate head, the Green Man/Wild Man, is a motif in architecture and art, a face composed of, or completely surrounded by, foliage, most often spreading out from the centre of the face. Apart from a purely decorative function, the Green Man is interpreted as a symbol of rebirth, representing the cycle of new growth that occurs every spring. Found in many cultures from many ages around the world, the Green Man is often related to natural vegetation deities. The female equivalent of the Green Man is often referred to as the Green Woman or the Sheela-Na-Gig. These figures. often depicted with a leafy crown or luxuriant hair, symbolising her connection to the natural world, are associated with fertility, nature, and the wild. In some contexts, the "Wild Woman" or the "Glaistig" (a type of sea spirit in Scottish folklore) can also be considered female equivalents of the Green Man, representing different aspects of nature's wildness and power.

Customer Reviews

4.8 out of 5 stars rating6.9K Total Reviews
6122 total 5-star reviews570 total 4-star reviews117 total 3-star reviews44 total 2-star reviews38 total 1-star reviews
6,891 Reviews
Reviews for similar products
5 out of 5 stars rating
By Dennis P.24 May 2023Verified Purchase
Magnet, Style: Circle, Size: Standard, 5.7 Cm
Zazzle Reviewer Program
I love it. The antique look awesome. A friend thought I'd had for years. 👍. Excellent writing and is very clear and sharp. 👍👌👍
5 out of 5 stars rating
By Michelle H.4 July 2023Verified Purchase
Magnet, Style: Circle, Size: Large, 7.6 Cm
Zazzle Reviewer Program
Great size, designed it all online and it was exactly as I designed it. Great sharp and clear image Arrived very quickly. I wished the photo was slightly brighter however this is how it was on the website when designing so it’s true to the design
5 out of 5 stars rating
By Paula H.10 July 2022Verified Purchase
Magnet, Style: Circle, Size: Large, 7.6 Cm
Zazzle Reviewer Program
High quality!!!!!!!!!! Brilliant design!!!!!!

Tags

Magnets
nature religiongoddessgreen womangreen manwild manfertilitymediaevalpaganwicca
All Products
nature religiongoddessgreen womangreen manwild manfertilitymediaevalpaganwicca

Other Info

Product ID: 256096699561023212
Posted on 23/04/2025, 10:04 AM
Rating: G