Tap / click on image to see more RealViewsTM
$131.16
each
 

Green Woman - Wood Sherpa Blanket

Qty:
Personalise this template

Other designs from this category

About Sherpa Blankets

Sold by

Size: Medium

Cuddle up to warmth and comfort in our most luxurious blanket yet, the Sherpa fleece blanket. Perfect for those nights when your baby says "It's cold outside!"

  • Available in 3 different sizes: small (76.2 cm x 101.6 cm); medium (127 cm x 152.4 cm); large (152.4 cm x 203.2 cm)
  • Blanket features vividly customised image on one side and the softest Sherpa available on the reverse
  • Material: 100% polyester printed mink with ultra-soft sherpa backing
  • Sherpa side is non-customisable and the colour is off-white
  • Edge-to-edge sublimation printing in vibrant full colour
  • Sturdy hand sewn edge stitching for a clean finish
  • Machine wash separately with warm water, gentle cycle, mild detergent
  • Tumble dry low; do not iron or dry clean
  • Wash before first use
  • This product is recommended for ages 2+

About This Design

Green Woman - Wood Sherpa Blanket

Green Woman - Wood Sherpa Blanket

A Green Woman carved in wood with paint applied to the oak leaves and hair. Customise by adding your own text. Also known as a foliate head, the Green Man/Wild Man, is a motif in architecture and art, a face composed of, or completely surrounded by, foliage, most often spreading out from the centre of the face. Apart from a purely decorative function, the Green Man is interpreted as a symbol of rebirth, representing the cycle of new growth that occurs every spring. Found in many cultures from many ages around the world, the Green Man is often related to natural vegetation deities. The female equivalent of the Green Man is often referred to as the Green Woman or the Sheela-Na-Gig. These figures. often depicted with a leafy crown or luxuriant hair, symbolising her connection to the natural world, are associated with fertility, nature, and the wild. In some contexts, the "Wild Woman" or the "Glaistig" (a type of sea spirit in Scottish folklore) can also be considered female equivalents of the Green Man, representing different aspects of nature's wildness and power.

Customer Reviews

4.8 out of 5 stars rating343 Total Reviews
301 total 5-star reviews24 total 4-star reviews8 total 3-star reviews4 total 2-star reviews6 total 1-star reviews
343 Reviews
Reviews for similar products
5 out of 5 stars rating
By Liza g.4 April 2022Verified Purchase
Medium
Zazzle Reviewer Program
The product came out amazing. And my daughter loved it , she was going to put it over wall or keep as a blanket. Either way she was over the moon. Happy with the outcome. Excellent work. It was good, it did cone upnwith a warning saying the pictures mybcime out bury , but nope all the pictures came out perfect. Will have to get a picture from my daughter when I see her to see what she done with it
5 out of 5 stars rating
By A.11 May 2022Verified Purchase
Small
Zazzle Reviewer Program
This blanket was beyond my expectations….it is EXCELLENT QUALITY, large size for a bed blanket. I love the product and production! I was very concerned that my painting would not be reproduced well on the item but IT WAS PERFECT, PERFECT, PERFECT! Very professional and quality workmanship! Wow! Wow! Wow! The printing of my painting on this blanket was absolutely EXCELLENT….SHARP, NOT BLURRY AND THE COLORS WERE REPRODUCED EXACTLY!
from zazzle.com (US)
5 out of 5 stars rating
By Sallie H.21 December 2020Verified Purchase
Small
Zazzle Reviewer Program
I ordered 7 Photo Blankets for my grandkids this Christmas. The quality of the printed pictures is AMAZING!! I am so excited to give them their gifts this year. Fantastically fast delivery as well. THANK YOU, Zazzle!!! You are AWESOME!!! Amazing Likeness to the original photos!! Loved the finished product!!
from zazzle.com (US)

Tags

Sherpa Blankets
green womangreen manwild mancustomnature religionarchitecturemediaevalfertilitywiccaenvironment
All Products
green womangreen manwild mancustomnature religionarchitecturemediaevalfertilitywiccaenvironment

Other Info

Product ID: 256441961554307293
Posted on 1/05/2025, 9:09 AM
Rating: G