Tap / click on image to see more RealViewsTM
$45.55
per shirt
 

Guardian Ancestor Hypatia, Men's T-Shirt

Qty:
Value T-Shirt
+$2.55
+$2.55
+$20.70
Black
Classic Printing: No Underbase
-$4.35
Vivid Printing: White Underbase

Other designs from this category

About T-Shirts

Sold by

Style: Men's Value T-Shirt

This classic silhouette is an affordable alternative heavyweight t-shirt for the value-conscious consumer. Rest assured as this t-shirt is pre-shrunk and made from 100% cotton. It also has double-needle stitched bottom and hems for extra durability.

Size & Fit

  • Model is 6'2"/188 cm and is wearing a Medium
  • Standard fit
  • Fits true to size

Fabric & Care

  • 5.4 oz. 100% cotton
  • 1x1 rib knit collar and shoulder-to-shoulder taping
  • Double-needle hem
  • Imported
  • Machine wash cold

About This Design

Guardian Ancestor Hypatia, Men's T-Shirt

Guardian Ancestor Hypatia, Men's T-Shirt

Guardian Ancestor Hypatia of Alexandria T-Shirt By Cherry Hill Seminary www.CherryHillSeminary.org Image Credit: "Hypatia by Julius Kronberg, 1889" (public domain) (BusDM)

Customer Reviews

4.7 out of 5 stars rating31.8K Total Reviews
24914 total 5-star reviews4900 total 4-star reviews1078 total 3-star reviews483 total 2-star reviews440 total 1-star reviews
31,815 Reviews
Reviews for similar products
5 out of 5 stars rating
By M s.4 May 2022Verified Purchase
Basic Long Sleeve T-Shirt, Ash, Adult L
Zazzle Reviewer Program
Product arrived bang on time, fit really well and our groomsmen absolutely loved them! Absolutely awesome product, images were perfect
5 out of 5 stars rating
By Elli J.1 February 2025Verified Purchase
Value T-Shirt, Black, Adult S
Great tee shirt. Delivered quicker than I expected. Many thanks.
5 out of 5 stars rating
By Tammy A.19 September 2020Verified Purchase
Value T-Shirt, White, Adult S
Zazzle Reviewer Program
Order you normal size. Nice heavy duty cotton. Great print, perfect for fathers day

Tags

All Products
paganpaganismmagickmagicwitchcraftwiccafaithreligionspiritualityseminary

Other Info

Product ID: 256979745856406409
Posted on 28/03/2025, 4:14 AM
Rating: G