Tap / click on image to see more RealViewsTM
$54.55
per shirt
 

Guardian Ancestor Hypatia, Women's T-Shirt

Qty:
Womens Basic T-Shirt
+$17.15
+$42.60
+$18.70
Black
Classic Printing: No Underbase
-$10.80
-$10.80
-$10.80
-$10.80
-$10.80
Vivid Printing: White Underbase

Other designs from this category

About T-Shirts

Sold by

Style: Women's Basic T-Shirt

This basic t-shirt features a relaxed fit for the female shape. Made from 100% cotton, this t-shirt is both durable and soft – a great combination if you're looking for that casual wardrobe staple. Select a design from our marketplace or customise it and unleash your creativity!

Size & Fit

  • Model is 5'7"/170 cm and is wearing a Small
  • Standard fit
  • Fits true to size

Fabric & Care

  • 100% cotton
  • Tagless label for comfort
  • Double-needle hemmed sleeves and bottom
  • Machine wash cold
  • Imported

About This Design

Guardian Ancestor Hypatia, Women's T-Shirt

Guardian Ancestor Hypatia, Women's T-Shirt

Guardian Ancestor Hypatia of Alexandria T-Shirt By Cherry Hill Seminary www.CherryHillSeminary.org Image Credit: "Hypatia by Julius Kronberg, 1889" (public domain) (BusDM)

Customer Reviews

4.6 out of 5 stars rating14.8K Total Reviews
10531 total 5-star reviews2863 total 4-star reviews826 total 3-star reviews380 total 2-star reviews246 total 1-star reviews
14,846 Reviews
Reviews for similar products
5 out of 5 stars rating
By H.31 March 2024Verified Purchase
My Clan Graham is high quality garment and its history even more important, Clan Graham fought for the right to wear kilts and won. Clan Graham, Duke of Montrose are advisors to China on renewable energy. Heavy duty Cotton. The design and colours are superb, I feel very proud as a Graham descendant from Appleby Westmorland Cumbria to wear this especially when wearing of patches is banned in Aotoearoa - New Zealand. Kiwis wear all black as the t shirt is with Green lettering to match the environment and yellow for joy and purple thistle to match my hair. The wardrobe police know who my Clan is now !
Original product
5 out of 5 stars rating
By M.11 June 2017Verified Purchase
Womens Basic T-Shirt, White, Adult L
Zazzle Reviewer Program
The tee shirt was of good quality and the photo true to original. The printing was just fine, as usual.
5 out of 5 stars rating
By Julia U.19 January 2024Verified Purchase
Womens Basic T-Shirt, White, Adult S
Zazzle Reviewer Program
It's a really great quality t. Shirt. The print was clear, and the colours great.

Tags

All Products
paganpaganismmagickmagicwitchcraftwiccafaithreligionspiritualityseminary

Other Info

Product ID: 256365616848291214
Posted on 28/03/2025, 4:19 AM
Rating: G