Tap / click on image to see more RealViewsTM
$41.15
per mug
 

Happy Bee Mug

Qty:
Combo Mug
-$4.05
-$1.95
+$16.85
Black

Other designs from this category

About Mugs

Sold by

Style: Combo Mug

Funny, unique, pretty, or personal, it's your choice for the perfect coffee mug. The outside of the mug features a bright white base for your photo, logo, pattern, or saying, while the rim & handle are vividly glazed in rich colour. Match or complement the colour of your existing dinnerware set, or gift your friend a mug in his or her favourite colour.

  • 325 ml or 443 ml
  • Dimensions:
    • 325 ml: 8.1 cm D x 9.7 cm H
    • 443 ml: 8.6 cm D x 11.4 cm H
  • Microwave and dishwasher safe
  • Use caution when removing the mug from the microwave. Use a pot holder or glove as necessary if it is too hot to the touch. Do not microwave an empty mug.
  • Strong, ceramic construction
  • Meets FDA requirements for food and beverage safety
  • Do not overfill and be careful with hot liquids that may scald
  • Keep out of reach of children when filled with hot liquid

About This Design

Happy Bee Mug

Happy Bee Mug

A cute cartoon bee with a big happy smile waving hello. This is an original illustration by me (not clip art). The motif is repeated on both sides of the mug.

Customer Reviews

4.8 out of 5 stars rating22.2K Total Reviews
19594 total 5-star reviews1854 total 4-star reviews342 total 3-star reviews155 total 2-star reviews275 total 1-star reviews
22,220 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Anonymous3 October 2025Verified Purchase
Combo Mug, 325 ml
My girlfriend loved it...was her birthday present from me .
5.0 out of 5 stars rating
5 out of 5 stars rating
By Lynda J.3 February 2020Verified Purchase
Combo Mug, 325 ml
Zazzle Reviewer Program
Professionally finished. Clear clean art work, makes this a gift to treasure. Arrived earlier than anticipated. I would give both 5 stars. The image quality was perfect. Could not fault it. Take time when ordering as this is an excellent gift presented professionally.
5.0 out of 5 stars rating
5 out of 5 stars rating
By C.22 November 2022Verified Purchase
Combo Mug, 325 ml
Zazzle Reviewer Program
Order was easy and communication great. Order arrived pretty quickly. Unfortunately 2 mugs broke in transit. Helena and the friendly team sent 2 new mugs which arrived safely. Communication was prompt, friendly and extremely helpful. Printing was perfect.

Tags

Mugs
beehappycutehoneybumbleflywaspinsectwildlifeanimals
All Products
beehappycutehoneybumbleflywaspinsectwildlifeanimals

Other Info

Product ID: 168668466921023645
Posted on 14/01/2009, 3:41 PM
Rating: G