Tap / click on image to see more RealViewsTM
$54.55
per shirt
 

Heavy Weights And Protein Shakes Workout Gym Fitne T-Shirt

Qty:
Basic Dark T-Shirt
-$2.55
+$18.15
Black
Vivid Printing: White Underbase

Other designs from this category

About T-Shirts

Sold by

Style: Basic Dark T-Shirt

Comfortable, casual and loose fitting, our heavyweight dark colour t-shirt will quickly become one of your favorites. Made from 100% cotton, it's unisex and wears well on anyone and everyone. We’ve double-needle stitched the bottom and sleeve hems for extra durability. Select a design from our marketplace or customise it to make it uniquely yours!

Size & Fit

  • Model is 188 cm and is wearing a medium
  • Standard fit
  • Garment is unisex sizing
  • Fits true to size

Fabric & Care

  • 100% cotton (Heathers are a cotton/poly blend)
  • Double-needle hemmed sleeves and bottom
  • Imported
  • Machine wash cold

About This Design

Heavy Weights And Protein Shakes Workout Gym Fitne T-Shirt

Heavy Weights And Protein Shakes Workout Gym Fitne T-Shirt

This cute Workout design also affects Gym & Fitness! It has to do with Training and also Motivation. Funny gift for Christmas or a birthday. Funny Heavy Weights And Protein Shakes present. Sport: The cool Weightlifting design is related to Bodyweight and Weightlifter! It also relates to Bodybuilder.

Customer Reviews

4.7 out of 5 stars rating32.1K Total Reviews
25111 total 5-star reviews4910 total 4-star reviews1099 total 3-star reviews489 total 2-star reviews452 total 1-star reviews
32,061 Reviews
Reviews for similar products
4 out of 5 stars rating
By Jarrod H.28 May 2025Verified Purchase
Basic Dark T-Shirt, Navy Blue, Adult S
I found the shirt quality itself to be well made. Unfortunately I found that the image quality of the artwork is low resoultion. So the art and words aren't as clear. I probably wont buy another shirt to be honest, but I'm glad I supported the podcast of which I'm a fan of. I was just hoping that for the price I paid, it would have been of better quality.
5 out of 5 stars rating
By B M.24 December 2022Verified Purchase
Basic Dark T-Shirt, Black, Adult S
Zazzle Reviewer Program
this was good quality and perfect colour. Printing was great although when we all opened our secret santa gifts one of the other mechanics commented whoever got that for him missed out part time after the word mechanic Sorry I don't have any photos
5 out of 5 stars rating
By Anonymous21 November 2024Verified Purchase
Basic Dark T-Shirt, Black, Adult L
The T-Shirt I ordered arrived promptly and in good condition. My partner loved it. Very pleased with this purchase. Fay B.

Tags

T-Shirts
alsodesignfunnybodybuilderproteinshakesweightliftingweightsheavyfitness
All Products
alsodesignfunnybodybuilderproteinshakesweightliftingweightsheavyfitness

Other Info

Product ID: 235308221130654641
Posted on 30/09/2021, 5:58 PM
Rating: G