Tap / click on image to see more RealViewsTM
$53.70
per hat
 

Hows the sauce? Hat

Qty:
Heads-up!
Sorry, this colour is temporarily sold out. Please select another colour.
  1. Size

  2. Style

  3. colour: Scotland Blue

Other designs from this category

About Embroidered Hats

Sold by

Style: Distressed Adjustable Cap

If you like the lived-in look, you'll love this enzyme-washed hat from District Threads. Comfortable as an old friend, it's 100% cotton and has an unstructured style with 6 panels and a low profile. Make it the perfect size with the metal D-ring slider buckle and hideaway cloth strap.

  • 100% cotton twill
  • Decoration style: digital embroidery
  • Low profile and unstructured
  • Metal D-ring slider buckle with hideaway strap closure
  • Due to a special finishing process, distress and colour may vary
  • Care instructions: machine wash cold, non-chlorine bleach when needed, tumble dry medium. Do not iron decorations or customisation

For some design guidance please see: How Do I Create a Design Suitable for Zazzle Embroidery

About This Design

Hows the sauce? Hat

Hows the sauce? Hat

Support Rankin’s Food reviews love of iced tea with this hat.

Customer Reviews

4.7 out of 5 stars rating1.2K Total Reviews
964 total 5-star reviews137 total 4-star reviews41 total 3-star reviews10 total 2-star reviews14 total 1-star reviews
1,166 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Debbie N.14 January 2024 • Verified Purchase
Embroidered Hat, Basic Adjustable Cap
Zazzle Reviewer Program
Good quality. Pleased with the Color. Exactly as I wanted. Thanks Zazzle.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Debbie4 January 2022 • Verified Purchase
Embroidered Hat, Distressed Adjustable Cap
Zazzle Reviewer Program
Excellent product, exactly as advertised. Perfect embroidery, everything as advertised, colours as well.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Innocent P.1 October 2021 • Verified Purchase
Embroidered Hat, Distressed Adjustable Cap
Zazzle Reviewer Program
It's super durable and the embroidery hasn't frayed or ripped at all! It's also adjustable in size! Super amazing. Hasn't come off or anything.
from zazzle.com (US)

Tags

hathatsballcapcaprankinrankinsreviewsrankinsfoodreviews

Other Info

Product ID: 256068027725727860
Posted on 27/09/2024, 6:10 AM
Rating: G