Tap / click on image to see more RealViewsTM
$48.05
per shirt
 

Keep Calm Plants Have Protein T-Shirt

Qty:
  1. Size

  2. Style

  3. Colour & Print Process: Black

    Vivid Printing: White Underbase

Other designs from this category

About T-Shirts

Sold by

Style: Basic Dark T-Shirt

Comfortable, casual and loose fitting, our heavyweight dark colour t-shirt will quickly become one of your favourites. Made from 100% cotton, it's unisex and wears well on anyone and everyone. We’ve double-needle stitched the bottom and sleeve hems for extra durability. Select a design from our marketplace or customise it to make it uniquely yours!

Size & Fit

  • Model is 188 cm and is wearing a medium
  • Standard fit
  • Garment is unisex sizing
  • Fits true to size

Fabric & Care

  • 100% cotton (Heathers are a cotton/poly blend)
  • Double-needle hemmed sleeves and bottom
  • Imported
  • Machine wash cold

About This Design

Keep Calm Plants Have Protein T-Shirt

Keep Calm Plants Have Protein T-Shirt

Keep Calm Plants Have Protein

Customer Reviews

4.7 out of 5 stars rating32.4K Total Reviews
25357 total 5-star reviews4926 total 4-star reviews1113 total 3-star reviews500 total 2-star reviews479 total 1-star reviews
32,375 Reviews
Reviews for similar products
4.0 out of 5 stars rating
4 out of 5 stars rating
By Jarrod H.28 May 2025Verified Purchase
Basic Dark T-Shirt, Navy Blue, Small
I found the shirt quality itself to be well made. Unfortunately I found that the image quality of the artwork is low resoultion. So the art and words aren't as clear. I probably wont buy another shirt to be honest, but I'm glad I supported the podcast of which I'm a fan of. I was just hoping that for the price I paid, it would have been of better quality.
5.0 out of 5 stars rating
5 out of 5 stars rating
By B M.24 December 2022Verified Purchase
Basic Dark T-Shirt, Black, Small
Zazzle Reviewer Program
this was good quality and perfect colour. Printing was great although when we all opened our secret santa gifts one of the other mechanics commented whoever got that for him missed out part time after the word mechanic Sorry I don't have any photos
5.0 out of 5 stars rating
5 out of 5 stars rating
By Alison T.2 January 2021Verified Purchase
Basic Dark T-Shirt, Navy Blue, Large
Zazzle Reviewer Program
Being a gift I was apprehensive regarding Quality size printing and delivery on time I need not have worried. Colour was perfect true to the photo and ex quality Being a heavier weight the t shirt probably more suitable for New Zealand’s Autumn and Winter Excellent printing quality

Tags

T-Shirts
plantsproteinkeepcalmhaveplantvegandieteatgift
All Products
plantsproteinkeepcalmhaveplantvegandieteatgift

Other Info

Product ID: 235340489353621483
Posted on 26/04/2022, 11:23 AM
Rating: G