Tap / click on image to see more RealViewsTM
$34.90
per towel
 

Kingfisher Bird Pond Wildlife Animal Kitchen Towel

Qty:

Other designs from this category

About Kitchen Towels

Sold by

Style: Tea Towel 40.6 cm x 61 cm

Brighten up any kitchen with a set of new kitchen towels! Made of durable poly-blend, these towels are great for drying and will look vibrant with your text, monogram or artwork. Designed for a lifetime of use, these machine washable kitchen towels look great and clean up well, too!

  • Dimensions: 40.6 cm x 60.9 cm
  • Durable woven polyester / polyamide blend microfibre; 80% Polyester / 20% Polyamide
  • Machine washable
  • Made and shipped from the USA
Creator Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 40.6 cm x 60.9 cm (16" x 24"). For best results please add 1.8 cm (5/7") bleed..

About This Design

Kingfisher Bird Pond Wildlife Animal Kitchen Towel

Kingfisher Bird Pond Wildlife Animal Kitchen Towel

Cool collage of vintage botanical fine art of Kingfisher Alcedo Birds and Cattails at a pond is on this Kitchen Towel. Image is public domain due to expired copyright. Collage is by me.

Customer Reviews

4.8 out of 5 stars rating1.2K Total Reviews
1013 total 5-star reviews118 total 4-star reviews37 total 3-star reviews13 total 2-star reviews16 total 1-star reviews
1,197 Reviews
Reviews for similar products
5 out of 5 stars rating
By Rebecca S.14 October 2023Verified Purchase
Kitchen Towel
Zazzle Reviewer Program
Great personalised gift for a friend that loves to Sail :). Great printing, clear picture
5 out of 5 stars rating
By MEGAN T.16 July 2023Verified Purchase
Kitchen Towel
Zazzle Reviewer Program
Great print, design and quality. Looks just like it does in the picture. It caught visitors eye
5 out of 5 stars rating
By Corinne D.7 February 2018Verified Purchase
Kitchen Towel
Creator Review
My photos don’t do the colors of my gorgeous kitchen towel justice. It’s absolutely beautiful! The printing is gorgeous!
from zazzle.com (US)

Tags

Kitchen Towels
birdswildlifeanimalskingfisherpondkitchen towelhand towelcattailswetlandskingfisher birds
All Products
birdswildlifeanimalskingfisherpondkitchen towelhand towelcattailswetlandskingfisher birds

Other Info

Product ID: 197316344225007716
Posted on 14/07/2019, 7:23 AM
Rating: G