Tap / click on image to see more RealViewsTM
Sale Price $27.80.  
Original Price $32.70 per mug
You save 15%

Kingfisher Birds Wildlife Pond Animals Mug

Qty:
Classic Mug
+$2.20
+$4.40
+$10.95
+$13.15
+$17.50
+$21.90

Other designs from this category

About Mugs

Sold by

Style: Classic Mug

Give a made-to-order mug from Zazzle to someone special, or treat yourself to a design that brings you joy or makes you laugh. Create your own photo mug, shop our collection of the funniest joke mugs, personalise your mug with a monogram, or express yourself with one of our 10 million designs.

  • Available in 325 ml or 443 ml
  • Dimensions:
    • 325 ml: 8.1 cm D x 9.7 cm H
    • 443 ml: 8.6 cm D x 11.4 cm H
  • Microwave and dishwasher safe
  • Use caution when removing the mug from the microwave. Use a pot holder or glove as necessary if it is too hot to the touch. Do not microwave an empty mug
  • Strong, ceramic construction
  • Meets FDA requirements for food and beverage safety
  • Do not overfill and be careful with hot liquids that may scald
  • Keep out of reach of children when filled with hot liquid

About This Design

Kingfisher Birds Wildlife Pond Animals Mug

Kingfisher Birds Wildlife Pond Animals Mug

Gorgeous collage of vintage botanical fine art of exotic Kingfisher Birds and pond habitat by Gould is on this Mug. Images are public domain due to expired copyright.

Customer Reviews

4.8 out of 5 stars rating21.7K Total Reviews
19173 total 5-star reviews1839 total 4-star reviews322 total 3-star reviews132 total 2-star reviews207 total 1-star reviews
21,673 Reviews
Reviews for similar products
5 out of 5 stars rating
By S.20 June 2021Verified Purchase
Classic Mug, 325 ml
Zazzle Reviewer Program
Very happy with the printing and overall quality of the personalized welcome pack for our employees. Great quality and placement, very happy with how it turn out!
5 out of 5 stars rating
By Kirsty D.7 May 2021Verified Purchase
Classic Mug, 325 ml
Zazzle Reviewer Program
Very pleased with the product. Arrived well packaged in one piece and looks good. Exactly as per picture.
5 out of 5 stars rating
By Debbie P.19 November 2023Verified Purchase
Classic Mug, 325 ml
Zazzle Reviewer Program
I have not gifted it yet, but know the person will love it. Awesome - nice and bold

Tags

Mugs
mugcoffee mugbirdswildlifeanimalskingfisherpondgouldvintage
All Products
mugcoffee mugbirdswildlifeanimalskingfisherpondgouldvintage

Other Info

Product ID: 168527610128357298
Posted on 11/10/2016, 2:11 AM
Rating: G