Tap / click on image to see more RealViewsTM
$31.50
per sticker
 

Let's go Sticker Car

Qty:

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by

Sticker Sheet Size: 35.56 cm x 35.56 cm

Design your own custom contour kiss-cut vinyl stickers. Upload one design for a single standout sticker, or add up to 30 different designs per sheet. Each sticker is individually kiss-cut with precision laser technology to match the exact shape of your artwork, giving you that clean die-cut look on an easy-peel vinyl sheet.

  • Sheet Size: 35.6 cm L x 14.12.7 cm W
  • Design Area: 35.6 cm L x 35.6 cm W
  • Up to 30 contour-cut stickers per sheet
  • Each sticker is cut to the exact shape of your image
  • Removable, low-tack adhesive that peels clean with no residue
  • Available in matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks: fade-proof, waterproof, and scratch-resistant
  • Available in 6 sizes
  • A 0.1212.7 cm border is added around each sticker to protect your design and help it pop on any surface
⚠️ WARNING! Choking hazard. Small parts. Not for children under 3 years.

About This Design

Let's go Sticker Car

Let's go Sticker Car

Ignite your adventures with our vibrant "Let’s Go" sticker! Designed to inspire spontaneity and a love for the open road, this eye-catching sticker features bold, dynamic typography that captures the thrill of exploration. Stick it on your bumper, window, or wherever you want to spread the spirit of adventure. Let the world know you’re ready to hit the road and embrace every journey that comes your way!

Customer Reviews

4.5 out of 5 stars rating45 Total Reviews
36 total 5-star reviews3 total 4-star reviews1 total 3-star reviews1 total 2-star reviews4 total 1-star reviews
45 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Jessica L.23 May 2024Verified Purchase
35.56 cm x 35.56 cm Custom-Cut Vinyl Stickers, Glossy clear
I looked at a few templates for creating my own and decided on this one as it was the clearest indication that 1. indeed the background would be removed (white) and 2. was water proof for car window or in my case motorcycle helmet. Turned out perfect, and they were easy to peel off. Ignore the little bumps in the photo as I had not smoothed it down when taking the pic yet
from zazzle.com (US)
5.0 out of 5 stars rating
5 out of 5 stars rating
By Kathryn T.19 July 2024Verified Purchase
35.56 cm x 35.56 cm Custom-Cut Vinyl Stickers, Glossy clear
New Mexico, transplant, military brat, dandelion, and New Mexico. Zia symbol. Land of enchantment. Love this window sticker helps me pick out my car out of a bunch of other white cars! The quality of the stickers wonderful and came out just the way I wanted! Love it! Satisfied customer. .
from zazzle.com (US)
5.0 out of 5 stars rating
5 out of 5 stars rating
By Karen M.13 September 2023Verified Purchase
35.56 cm x 35.56 cm Custom-Cut Vinyl Stickers, Matte White
Creator Review
Our organization, Ormond Scenic Loop and Trail, had these printed to cut apart and sell/give away at community events as car decals. They have been very well accepted and a good way to get our name out at a low cost. I'm happy with the quality and the designs have lasted well and resisted fading even on the back windshield of my car which sits outside with the hot Florida sun beating down on it. The printing was acceptable.
from zazzle.com (US)

Tags

Custom-Cut Vinyl Stickers
letsgostickeradventurestickertravelstickerroadtripstickerbumperstickervinylcarstickercaraccessoriestravelessentialsmotivationalstickercustomsticker
All Products
letsgostickeradventurestickertravelstickerroadtripstickerbumperstickervinylcarstickercaraccessoriestravelessentialsmotivationalstickercustomsticker

Other Info

Product ID: 256880978172582416
Posted on 9/10/2024, 1:12 AM
Rating: G