Tap / click on image to see more RealViewsTM
$94.55
per poster
 

Medieval Chainmail Patent Blueprint Poster

Qty:
  1. Size: 60.96 cm x 81.28 cm

    Find your size.
  2. Paper Type

  3. Border

Other designs from this category

About Posters

Sold by

Paper Type: Standard Semi-Gloss

Your walls are a reflection of your personality, so let them speak with your favorite quotes, art, or designs printed on our custom Giclee posters! High-quality, microporous resin-coated paper with a beautiful semi-gloss finish. Choose from standard or custom size posters and framing options to create art that’s a perfect representation of you.

  • Gallery quality Giclee prints
  • Ideal for vibrant artwork and photo reproduction
  • Semi-gloss finish
  • Pigment-based inks for full-color spectrum high-resolution printing
  • Durable 185gsm paper
  • Available in custom sizing up to 60”
  • Frames available on all standard sizes
  • Frames include Non-Glare Acrylic Glazing

About This Design

Medieval Chainmail Patent Blueprint Poster

Medieval Chainmail Patent Blueprint Poster

Vintage patent-style illustration of chainmail armour with knight figure and construction diagrams, emphasising rivets, texture, and medieval craftsmanship for a unique apparel motif.

Customer Reviews

4.8 out of 5 stars rating14.6K Total Reviews
12458 total 5-star reviews1349 total 4-star reviews273 total 3-star reviews158 total 2-star reviews317 total 1-star reviews
14,555 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Donna Y.2 June 2022Verified Purchase
Print, Size: 60.96cm x 91.44cm, Media: Standard Semi-Gloss
Zazzle Reviewer Program
I originally ordered this print in a larger size but was not pleased with the clarity of it. When I contacted Zazzle, they responded really quickly and were very helpful. I was able to reorder the print in a smaller size and it was shipped to me within a couple of weeks. The print was packaged well to ensure there was no damage during transit (Eco friendly, too!), and I am really pleased with it. I am so grateful to the customer service team for the professional way they handled my order. I had this printed on matt finish card and I was really pleased with the quality. The colours were rich and the image sharp.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Mignon G.22 December 2021Verified Purchase
Print, Size: 41.91cm x 64.77cm, Media: Standard Semi-Gloss
Zazzle Reviewer Program
Very happy with this product. No complaints.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Mignon G.22 December 2021Verified Purchase
Print, Size: 45.72cm x 60.96cm, Media: Standard Semi-Gloss
Zazzle Reviewer Program
Very happy with this product. No complaints.

Tags

Posters
armourknightmedievalcraftsmanshipmedieval armorarmormedieval lovermedieval giftchainmailmedieval design
All Products
armourknightmedievalcraftsmanshipmedieval armorarmormedieval lovermedieval giftchainmailmedieval design

Other Info

Product ID: 256234444112308138
Posted on 8/01/2026, 9:59 PM
Rating: G