Tap / click on image to see more RealViewsTM
$9.35
per invitation
 

Modern Purple and Silver Photo Wedding Tri-Fold Invitation

Qty:
  1. Orientation

  2. Size

  3. Envelopes

  4. Paper Type

Other designs from this category

About Trifold Letter Fold Invitations

Sold by

Size: 12.7 cm x 17.8 cm

An invitation for every occasion! The tri-fold letter fold design has more space to include all your important details.

  • Dimensions: 12.7 cm x 17.8 cm tri- fold
  • Full CMYK print process
  • Printing on all sides for no additional cost
  • Standard white envelopes included

Paper Type: Signature Matte

Our Signature Matte paper is a customer favourite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle

About This Design

Modern Purple and Silver Photo Wedding Tri-Fold Invitation

Modern Purple and Silver Photo Wedding Tri-Fold Invitation

Modern, elegant, calligraphy script, marbled royal purple in combination with silver grey back details. Stylish, luxury tri-fold wedding invitation with custom photo inside. Add your photo, wedding details and rsvp.

Customer Reviews

4.6 out of 5 stars rating299 Total Reviews
242 total 5-star reviews29 total 4-star reviews8 total 3-star reviews7 total 2-star reviews13 total 1-star reviews
299 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Nichole R.18 May 2024Verified Purchase
Trifold Letter Fold Invitation, Size: 12.7 cm x 17.8 cm, Paper: NullValue, Envelopes: NullValue
The invitations came out absolutely beautiful. We have received a lot of compliments on them. We were very happy with how they turned out. Overall they were good. There were a few that we cut improperly so I am glad we ordered some extra ones.
from zazzle.com (US)
5.0 out of 5 stars rating
5 out of 5 stars rating
By JoAnn T.30 June 2022Verified Purchase
Trifold Letter Fold Invitation, Size: 12.7 cm x 17.8 cm, Paper: NullValue, Envelopes: NullValue
Zazzle Reviewer Program
I loved working with Zazzle start to finish. I was able to edit the invitation with the colors and even change some of the layout to create the exact invitation we wanted. We had pictures, added our story, and even used the back for a fun sequence going in for a kiss. When we submitted the purchase they looked over the document, had us correct some things due to a licensing issue, and when all was cleared the process began. Then we had an issue come up that needed us to change the date. Luckily the printing hadn't happened yet so we were able to cancel the order and reissue the card. When we got it we were very impressed! High quality paper and finish, and everything looked great. We would definitely recommend this company and this product! The finished product was amazing! Very high quality!
from zazzle.com (US)
5.0 out of 5 stars rating
5 out of 5 stars rating
By Bethany M.18 February 2022Verified Purchase
Trifold Letter Fold Invitation, Size: 12.7 cm x 17.8 cm, Paper: NullValue, Envelopes: NullValue
Zazzle Reviewer Program
These invites were the perfect way to let our guests know of the details for our upcoming day. Our theme is celestial, and these invitations set the tone for it perfectly! They arrived in a very timely manner and the format was easy to adjust to our details. Would very much recommend this artist and Zazzle to any bride or groom to be! The quality of printing was marvelous and had a great finish to it. No marks or scratches were to be found. They also hold up well in the mail system as well when people send back their RSVP’s.
from zazzle.com (US)

Tags

All Products
photomodernpurpleweddingelegantgreysimplefaux silvertypographycalligraphy script

Other Info

Product ID: 256197997045476690
Posted on 19/02/2020, 5:46 AM
Rating: G