Tap / click on image to see more RealViewsTM
The lace detailed are simulated in the artwork. No actual lace will be used in the making of this product.
$46.40
per keychain
 

Monogram Gold Filigree Motif Key Chain

Qty:
Premium Square
-$25.45
-$26.60
-$25.45
+$1.20
Large (5.1 cm)

Other designs from this category

About Keychains

Sold by

Style: Premium Square Keychain

You will never lose your keys or forget your favourite memory with this custom square keyring from Zazzle. The waterproof, UV coating will keep your images looking like new for years to come and keep your memories fresh as if they just happened yesterday!

  • Dimensions:
    • Measurements: 5.08 cm l x 5.08 cm w
    • Depth: 0.48 cm
    • Weight: 20 g
  • Full-colour, full-bleed printing
  • Silver-coloured metal charm & ring
  • UV resistant and waterproof
Designer Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 4.65 cm x 4.65 cm. For best results please add 1.6 mm bleed

About This Design

The lace detailed are simulated in the artwork. No actual lace will be used in the making of this product.
Monogram Gold Filigree Motif Key Chain

Monogram Gold Filigree Motif Key Chain

*Customise with your text.

Customer Reviews

4.6 out of 5 stars rating5.4K Total Reviews
4205 total 5-star reviews780 total 4-star reviews211 total 3-star reviews113 total 2-star reviews96 total 1-star reviews
5,405 Reviews
Reviews for similar products
5 out of 5 stars rating
By Vicki M.7 January 2017Verified Purchase
Zazzle Reviewer Program
Was very happy with the keyring. Very good communication and fast delivery. The photo turned out excellent
Original product
5 out of 5 stars rating
By C.17 January 2023Verified Purchase
Metal Circle Keychain, 5.08 cm
Zazzle Reviewer Program
A quality product with a bit of weight to it. Very pleased with my purchase. Colours and design are great, very happy with my Ukraine key ring
5 out of 5 stars rating
By Gloria G.16 April 2020Verified Purchase
Premium Square Keychain, Large (5.08 cm)
Zazzle Reviewer Program
I wanted a key chain to remember my husband and son lost to cancer. Great quality and sharpnbess
from zazzle.com (US)

Tags

Keychains
monogramclassychicelegantprettyfiligreelacesquareblackgold
All Products
monogramclassychicelegantprettyfiligreelacesquareblackgold

Other Info

Product ID: 146482276042163762
Posted on 17/06/2017, 7:53 PM
Rating: G