Tap / click on image to see more RealViewsTM
$74.80
per cushion
 

Mr & Mrs photo Cushion

Qty:
Throw Cushion 40.6 x 40.6 cm
+$13.95
+$38.00

Other designs from this category

About Cushions

Sold by

Size: Throw Cushion 40.6 x 40.6 cm

Accent your home with custom cushions from Zazzle and make yourself the envy of the neighbourhood. Made from high-quality Simplex knit fabric, these 100% polyester cushions are soft and wrinkle-free. The heavyweight stretch material provides beautiful colour definition for your design while also being the perfect complement to your sofa!

  • Dimensions: 40.6 cm x 40.6 cm (square)
  • Simplex knit fabric; 100% polyester; wrinkle-free
  • Hidden zip enclosure; synthetic-filled insert included
  • Machine washable
Designer Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 40.6 cm x 40.6 cm. For best results, please add 1.5 cm bleed.

About This Design

 Mr & Mrs photo Cushion

Mr & Mrs photo Cushion

Celebrate love in elegant style with this timeless "Mr. & Mrs." script design. Featuring modern calligraphy with a romantic touch. Perfect for yourself or as a gift. Whether you're personalising for yourself or as a gift, this classic motif adds a sophisticated and heartfelt touch to any occasion.

Customer Reviews

4.7 out of 5 stars rating215 Total Reviews
174 total 5-star reviews31 total 4-star reviews5 total 3-star reviews3 total 2-star reviews2 total 1-star reviews
215 Reviews
Reviews for similar products
5 out of 5 stars rating
By Lisa C.27 November 2023Verified Purchase
Throw Cushion, Throw Cushion 40.6 x 40.6 cm
Zazzle Reviewer Program
I bought this for my niece as part of a Bridal Shower Gift. I made my own revisions to the design, so I was a little nervous about it all. I'm super happy though with the end result! I changed out the background and revised all the text (on the back side as well). Printing turned out just wonderful!
from zazzle.com (US)
5 out of 5 stars rating
By Joanna M.8 April 2023Verified Purchase
Throw Cushion, Throw Cushion 40.6 x 40.6 cm
Zazzle Reviewer Program
Always have a great experience making custom pillows. Beautiful fabric and soft. Always meet my expectations! The colors with white background and clear printing was exceptional. They will cherish this gift!!
from zazzle.com (US)
5 out of 5 stars rating
By Sonja C.6 July 2016Verified Purchase
Throw Cushion, Throw Cushion 40.6 x 40.6 cm
Zazzle Reviewer Program
It was fun to be able to personalize it for the couple. It fit the theme of the bridal shower. My daughter was thrilled when she saw it. I had cleaned up and spray painted a wicker chair for her to sit on during the shower and this pillow was placed on it as a special touch. It drew a lot of attention from the guests. It was great! Printing was crisp and exactly as I personalized it. It was a perfect piece for the shower.
from zazzle.com (US)

Tags

Cushions
mr and mrsgiftkeepsakenewlywedsscriptjust marriedelegantcouples giftweddinganniversary
All Products
mr and mrsgiftkeepsakenewlywedsscriptjust marriedelegantcouples giftweddinganniversary

Other Info

Product ID: 256765352674582625
Posted on 7/08/2025, 5:15 AM
Rating: G