Tap / click on image to see more RealViewsTM
$37.30
per shirt
 

MVK Fighting Together T-Shirt

Qty:
Basic T-Shirt
-$6.25
+$14.50
White
Classic Printing: No Underbase
+$2.10
+$2.10
+$2.10
+$2.10
+$2.10
+$2.10
+$2.10
+$2.10
+$2.10
+$2.10
+$2.10
+$2.10
+$2.10
Vivid Printing: White Underbase
+$10.40
+$10.40
+$10.40
+$10.40
+$10.40
+$10.40
+$10.40
+$10.40
+$10.40
+$10.40
+$10.40
+$10.40
+$10.40

Other designs from this category

About T-Shirts

Sold by

Style: Men's Basic T-Shirt

Comfortable, casual and loose fitting, our heavyweight t-shirt will easily become a closet staple. Made from 100% cotton, it's unisex and wears well on anyone and everyone. We’ve double-needle stitched the bottom and sleeve hems for extra durability.

Size & Fit

  • Model is 185 cm and is wearing a medium
  • Standard fit
  • Garment is unisex sizing
  • Fits true to size

Fabric & Care

  • 100% cotton (Heathers are a cotton/poly blend)
  • Double-needle hemmed sleeves and bottom
  • Machine wash cold, tumble dry low
  • Imported

About This Design

MVK Fighting Together T-Shirt

MVK Fighting Together T-Shirt

Fighting Together supporting Mevalonate kinase deficiency (MVK disease)

Customer Reviews

4.6 out of 5 stars rating55.4K Total Reviews
42176 total 5-star reviews9199 total 4-star reviews2256 total 3-star reviews1016 total 2-star reviews784 total 1-star reviews
55,431 Reviews
Reviews for similar products
5 out of 5 stars rating
By Stuart B.28 June 2025Verified Purchase
Basic Dark T-Shirt, Black, Adult L
Excellent design platform, great quality material and printing, and quick delivery: couldn't ask for more...
5 out of 5 stars rating
By Shelley M.3 October 2022Verified Purchase
Value T-Shirt, White, Adult L
Zazzle Reviewer Program
I was really pleased with this shirt, the quality of the Tshirt was excellent, the artwork and print stands out and the fit is true to size....my son loved this for his 16th birthday 😀. Very good quality and color
5 out of 5 stars rating
By Vivienne C.9 June 2023Verified Purchase
Basic T-Shirt, White, Adult S
Zazzle Reviewer Program
AAA+++ Perfect gift for my old dad. He loved it - highly recommend and will buy again. Printing looked perfect to me

Tags

T-Shirts
fmfandaidglobalautoinflammatorydiseasesmevalonatekinasedeficiencymvkdisease
All Products
fmfandaidglobalautoinflammatorydiseasesmevalonatekinasedeficiencymvkdisease

Other Info

Product ID: 256138967277778890
Posted on 23/10/2024, 12:28 AM
Rating: G